SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016530 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016530
Domain Number 1 Region: 12-139
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.28e-27
Family Ankyrin repeat 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016530   Gene: ENSTNIG00000013534   Transcript: ENSTNIT00000016743
Sequence length 493
Comment pep:known_by_projection chromosome:TETRAODON8:4:4000407:4001888:1 gene:ENSTNIG00000013534 transcript:ENSTNIT00000016743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CNPGGAVDSGVPLLRAVFLRRLRLTRLLLEGGAYINESDGQGQTPLMVACRTQHCDAQSA
SRVKLVQFLLEKGADPNIQDKEGRSALMHACLEQAGAEVVSLLLDSGADISLEDHSGTSA
LVYAVTARELKVLKLLLDRCKAQGKEVIIIATDKLPYERLQAKQYISMPSLSLDPAAPAS
PSEIQLITSPMCPASSVCPPKTLFSFKEDPSRGRSSHPCSPSHFQRLGQAAPLQQPLLRL
NSEPWLKIPETLLAKQLQTASEDDEDLVQLPLGVPNLDESSCRCEDRPVKRLEGKETEDG
VKQTMALPLSTHSASHPNLHSANMGTDSSSSLPGNKHLSSPVHGAASSSLHSIIQRRKVG
ADIYSSDPQLALDVQNVPHDSQRAKDPADGKRLPPLRCCSTLGSGESRRRLPGFERRGSG
AYLLEHSSQARPRTLPPLTFIPSNTPVLASLCAKEQGPKHAFPSAPPGHPKEPTRRMLLR
RHSIQTEQFKSTA
Download sequence
Identical sequences H3D7N9
99883.ENSTNIP00000016530 ENSTNIP00000016530 ENSTNIP00000016530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]