SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016548 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016548
Domain Number 1 Region: 686-971
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.77e-79
Family Protein kinases, catalytic subunit 0.00000000081
Further Details:      
 
Domain Number 2 Region: 307-499
Classification Level Classification E-value
Superfamily L domain-like 2.69e-47
Family L domain 0.0000267
Further Details:      
 
Domain Number 3 Region: 22-188
Classification Level Classification E-value
Superfamily L domain-like 4.25e-34
Family L domain 0.0000423
Further Details:      
 
Domain Number 4 Region: 485-617
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.36e-22
Family Growth factor receptor domain 0.00000358
Further Details:      
 
Domain Number 5 Region: 168-312
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.59e-17
Family Growth factor receptor domain 0.00000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016548   Gene: ENSTNIG00000013552   Transcript: ENSTNIT00000016761
Sequence length 1018
Comment pep:known_by_projection chromosome:TETRAODON8:4:3874765:3880837:1 gene:ENSTNIG00000013552 transcript:ENSTNIT00000016761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKICQGTSNRLNLLGNYENHYETMLRMFSNCSVVLENLEVTYAQKHHSLAFLQSIEEVVG
YVLIGMNDVAVVPLGNLRLIRGQSLYDGQFSLLVLSNYKRNPASPSGFSGLRQLQLSNHS
EIIRGAVKITHNFLLCNIETIQWGDIVDSSSEPSIVLEKNESRASGESCDPSCDNGSCWA
AGPDHCQKITKLQCAEQCSRRCRGPKPSDCCNRHCAAGCTGPQADQCLACRDFNDEGTCK
DTCRSHMFHNSKIHRGVPNPDAKYAFGPICVKACPHNYVVTEGWCVRTCRAGMFEVEENG
VQQCRECNGPCPKVCDGLGVGAFNNSVAVNASNIEFFRNCTKINGNVNFIETSFTGDLFH
NIPPMDPAKLEYFRTVKEITGFLLIQSWPENLTSLSAFENLHIIRGRATHNMRTSLVVTR
TEHLRWLGLRSLKEVSAGRVMVKNNPQLCFLQPLQWTHLFRSTGQTADIRNNKPVDVCKQ
QRQTCDPECSDQGCWGPGPEMCVSCLRVSRGGRCVPLCNVLDGDPREAELNGSCVSCHSE
CQPQTGIPTCHGPGPGQCSQCAHVQDGPSCVAHCPQGMLGEGDTEIWMYPDRAGRCQLCH
QNCTQGCSGPGLSGCTSSAGQSTLAVCVVGGLLIVVIVALVTFVLLRRRRITRRRTLRRQ
LQEKELVEPLTPSGEAPNQAMLRIMKETEFKKIRVLGSGAFGTVYKGLWIPEGENVRVSV
AIKVLREATSSKANKEILDEAYVMASIDHPHVCRLLGICLTSSIQLVTQLMPFGCLLDYV
RFHQDQIGAPWLLNWCVQIAKGMSYLEGRHLVHRDLAARNVLVKSPSHVTITDFGLAKLL
TANEKAYRADGGKVPIKWMALESILQSTYTHQSDVWSFGVTVWELMTFGSKPYDGIPASE
ISSVLERGERLPHPPICTTDLYMIMVQCWMIDPSSRPTFRKLTAEFSTMARDPSRFLVVQ
ANLPSPTNRRFYSRMLSSEDMEGVIDADEYLQPYKEFGNHGDNSCSHTVAAHSSSITS
Download sequence
Identical sequences H3D7Q7
ENSTNIP00000016548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]