SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016561 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016561
Domain Number 1 Region: 293-501
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.9e-57
Family DNA polymerase beta-like 0.00000296
Further Details:      
 
Domain Number 2 Region: 141-230
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 3.4e-24
Family DNA polymerase beta, N-terminal domain-like 0.0001
Further Details:      
 
Domain Number 3 Region: 235-290
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 8.83e-16
Family DNA polymerase beta-like, second domain 0.00058
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016561
Domain Number - Region: 40-120
Classification Level Classification E-value
Superfamily BRCT domain 0.00135
Family DNA topoisomerase II binding protein 1, TopBP1 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016561   Gene: ENSTNIG00000013564   Transcript: ENSTNIT00000016775
Sequence length 502
Comment pep:known_by_projection chromosome:TETRAODON8:4:3729998:3732623:1 gene:ENSTNIG00000013564 transcript:ENSTNIT00000016775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITKSTMVPLKRRKLVSSHTENVEAKGSETTVKFPQIVIFLVERKMGASRRVFLSQLGRSK
GFKVEELYSERITHVVSENNCIDEVRTWLESHVRGQSLPPAHLLDVSWYTESMRAGHPVE
ILERHKLQEQQDNESEDVFSVPNYACQRRTTLQNHNTVLTEALSILAENAELNEEDGRGI
AFRRAEAVLKALPRAVRKLTELKGLPCLGEHSLRIIKDILEKGVSSEVEATKQSERYKAL
KLLTGIFGVGAKTADRWITMGIYNLQQLQSSGPTLNQAQQAGLEHYEDLNQPVTRAEADH
IGEIVRRVVLCVLPGAQLTLIGGFRRGKPTGHDVDFLITHPEEGREVGLLPKVVSLLKSQ
GFLLYQKTTKNSYLESEDRPTQPSSNMDRFERCFSIFRLKSHQESAEVRGNGSESRPKSW
RAVRVDLVVSPISQFAFALLGWTGSKLFERELRRWAGHEKAMSLSSHALYDTKQNSYLRA
ASEEEIFAHLDLEYIPPSERNA
Download sequence
Identical sequences H3D7S0
ENSTNIP00000016561 ENSTNIP00000016561 99883.ENSTNIP00000016561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]