SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016570 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016570
Domain Number 1 Region: 999-1146
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-42
Family C-type lectin domain 0.00000395
Further Details:      
 
Domain Number 2 Region: 108-217
Classification Level Classification E-value
Superfamily C-type lectin-like 9.89e-37
Family Link domain 0.0011
Further Details:      
 
Domain Number 3 Region: 218-311
Classification Level Classification E-value
Superfamily C-type lectin-like 3.42e-26
Family Link domain 0.0046
Further Details:      
 
Domain Number 4 Region: 2-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000132
Family V set domains (antibody variable domain-like) 0.031
Further Details:      
 
Domain Number 5 Region: 1146-1204
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000264
Family Complement control module/SCR domain 0.0035
Further Details:      
 
Domain Number 6 Region: 942-983
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000436
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016570   Gene: ENSTNIG00000013573   Transcript: ENSTNIT00000016784
Sequence length 1233
Comment pep:known_by_projection chromosome:TETRAODON8:4:3546072:3559984:-1 gene:ENSTNIG00000013573 transcript:ENSTNIT00000016784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTGSLASRVVLPCHFSMIPHTPSPTTPAPGIKWTKLEAQGEKMVLVAQNGMVKVGQEYVG
RVSVPSHPLSVRDASLIIARVRTSDAGLYSCEVMHGMEDSRDTISLNVTGVVFHYRDKAS
RYSLDFLGAVLACQAAGAAIATPEQLRTAFEDGLNQCDAGWLSDRSVRYPITVPRPGCTG
DLLGKPGVRTYGIRDPTEKYDVYCYVDKLKGEVFYPPLSTKLTLQQAKDECHKHDSVIAS
TGQLFAAWREGLNGCDYSWLSDGSVRYPVTIPRPQCGGGLLGVRTLYKYENQTGFPDPAE
KFGVYCFKGFIHNPTLSLGSLPELTTVGPSATPLGDKLAHSPMIHAAVDPERAEIQARTP
EPVPYLSAERANTASPDQQGAPRSDGGPTAVASTPTPVPEVKVPDSTHSDFVPPRGDVLA
PLQLPPLPTTRSKPSQLDIFQGLGDGGQTASGREDVTPGPGLTFDKSPAVPAVEESAKPP
FHLIIVNVNDKNQSVSISTSLTSSEPIPFASAWNKIFLNPFLLHGLTSSPFRQMTYFSEP
FCACHMVLSGPDRLWLCCYRLLTSPQTQTRGVFFISTMGGLLNNSMWHRPRGALIPKVFK
VTTISLTVNQNGETVEPPPIPAMSTTNYSLNLQVTFEPPLPEEARGDQFETATSSHFGEV
EVDEQEGLSVTPFNYAAIEIHTDGIPTEEPSNAVTQLPDTDPEAITVPKIHANLIPDLFR
VENGVKFPETGDKTSMRTTTIIPHTSVSSPALTTAPGSTFRGTPEPGADGVAPCGDMEDS
SSCGGGEEPDVPSEGSADDAPPTPAVDTQSSIRTDETETDGTELSTVIPDTLPRDPTTRP
QTDNEGSASGEDEASGQDMDPSETPRLTSTLPPLYSSLRSQQPPLVAGAEVTGVPVVLPH
VDTVTEAGSGAEQLPRQEEGSGENIGLTDLPPEVSVTPLPDLLPCSTSACQNGGSCYKNG
PQDACMCAPGFTGQRCETEVDECQPNPCLNGATCVDGPGSFSCVCMPSYTGELCEQDTEV
CGFGWEKFQSHCYKYMTHRRTWDAAERECRLHGAHLTSILSPEEQHFVNRLGSDYQWIGL
NDRMFERDFRWTDGSPMQYDNWRPNQPDSFFQSGEDCVVMIWHEGGQWNDVPCNYHLTFT
CKKGTVSCGQPPVVKDARLFGAIKPRGQHSLLRYHCRQGLIQRHAPTIRCRANGQWDLPR
VTCTSRRRSNQNSDQQNWRLNHHVHHHFRSQQE
Download sequence
Identical sequences H3D7S9
99883.ENSTNIP00000016570 ENSTNIP00000016570 ENSTNIP00000016570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]