SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016571 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016571
Domain Number 1 Region: 577-723
Classification Level Classification E-value
Superfamily C-type lectin-like 1.08e-42
Family C-type lectin domain 0.00000395
Further Details:      
 
Domain Number 2 Region: 79-188
Classification Level Classification E-value
Superfamily C-type lectin-like 1.04e-37
Family Link domain 0.0011
Further Details:      
 
Domain Number 3 Region: 190-284
Classification Level Classification E-value
Superfamily C-type lectin-like 1.08e-26
Family Link domain 0.0046
Further Details:      
 
Domain Number 4 Region: 2-81
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000017
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 
Domain Number 5 Region: 723-780
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000158
Family Complement control module/SCR domain 0.0041
Further Details:      
 
Domain Number 6 Region: 556-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000547
Family EGF-type module 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016571   Gene: ENSTNIG00000013573   Transcript: ENSTNIT00000016785
Sequence length 783
Comment pep:known_by_projection chromosome:TETRAODON8:4:3546271:3559852:-1 gene:ENSTNIG00000013573 transcript:ENSTNIT00000016785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIKWTKLEAQGEKMVLVAQNGMVKVGQEYVGRVSVPSHPLSVRDASLIIARVRTSDAGLY
SCEVMHGMEDSRDTISLNVTGVVFHYRDKASRYSLDFLGAVLACQAAGAAIATPEQLRTA
FEDGLNQCDAGWLSDRSVRYPITVPRPGCTGDLLGKPGVRTYGIRDPTEKYDVYCYVDKL
KGEVFYPPLSTKLTLQQAKDECHKHDSVIASTGQLFAAWREGLNGCDYSWLSDGSVRYPV
TIPRPQCGGGLLGVRTLYKYENQTGFPDPAEKFGVYCFKAERANTASPDQQGAPRSDGGP
TAVASTPTPVPEVKPLITEALVNGGRGALDPVSTSVSRCGGGEEPDVPSEGSADDAPPTP
AVDTQSSIRTDETETDGTELSTVIPDTLPRDPTTRPQTDNEGSASGEDEASGQDMDPSET
PRLTSTLPPLYSSLRSQQPPLVAGAEVTGVPVVLPHVDTVTEAGSGAEQLPRQEEGSGEN
IGLTDLPPEVSVTPLPDVEAVTSETSARAYPTQPSFVSPDDKKQPFMGRALTTAPPSQPY
SLQTDQSTTTSKPHTKVDECQPNPCLNGATCVDGPGSFSCVCMPSYTGELCEQDTEVCGF
GWEKFQSHCYKYMTHRRTWDAAERECRLHGAHLTSILSPEEQHFVNRLGSDYQWIGLNDR
MFERDFRWTDGSPMQYDNWRPNQPDSFFQSGEDCVVMIWHEGGQWNDVPCNYHLTFTCKK
GTVSCGQPPVVKDARLFGAIKPRYEVSTLRYHCRQGLIQRHAPTIRCRANGQWDLPRVTC
TSR
Download sequence
Identical sequences H3D7T0
ENSTNIP00000016571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]