SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016572 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016572
Domain Number 1 Region: 161-257
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-37
Family Link domain 0.0037
Further Details:      
 
Domain Number 2 Region: 269-354
Classification Level Classification E-value
Superfamily C-type lectin-like 1.54e-24
Family Link domain 0.0023
Further Details:      
 
Domain Number 3 Region: 49-156
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000265
Family V set domains (antibody variable domain-like) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016572   Gene: ENSTNIG00000013574   Transcript: ENSTNIT00000016786
Sequence length 355
Comment pep:known_by_projection chromosome:TETRAODON8:4:3540205:3542551:1 gene:ENSTNIG00000013574 transcript:ENSTNIT00000016786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPALICALIALSSANNDLNSLYPELEHSRTIYVTGADRGPRLSVAAEQTKVVSRRGGNA
TLPCKIQRDQSLAPNRKMRIKWTKLTSDYLKEVDVFVAMDYHKRSYGSFHGRVHLQGSSP
MDASLVITEITLEDYGRYKCEVIDGLEDGTAVVTLDLEGIVFPYFPRLGRYNLNFFDAER
ACREQDATVASFDQLHEAWQGKLDWCNAGWLSDGSVQYPINIPREPCGGKNTLPGIRSYG
LRDKEKNHYDVFCFTSYFKGRFYYLIQPFKLTYDEAVRACQKDGAQIAKVGQMYAAWKLL
GYDRCDAGWLADGSVRYPITQPRQRCSPTEAAVRFSGFPDKKHKLYGVYCFKGHN
Download sequence
Identical sequences H3D7T1
ENSTNIP00000016572 99883.ENSTNIP00000016572 ENSTNIP00000016572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]