SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016589 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016589
Domain Number 1 Region: 280-436,481-525
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-44
Family SPRY domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016589
Domain Number - Region: 48-96
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0224
Family PHD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016589   Gene: ENSTNIG00000013590   Transcript: ENSTNIT00000016803
Sequence length 568
Comment pep:known_by_projection chromosome:TETRAODON8:4:3316292:3320987:1 gene:ENSTNIG00000013590 transcript:ENSTNIT00000016803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DASFGELPASMDTESSNGKEGVETAAESSEAADTLTGSGDEESGRQLGEVELQCALCMKW
FTADTFGIDTATCLPFMTNYVFHCNVCHHSGNTYFLRKQANLKEMCLTALANLTWRSRTQ
DEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKVTWPNNIVKTMSKERDVFLVKERPDPA
SKDPEEEYPKFGLLDQDLGTIGPSYDTQKQTTAAPTTGGLNEGALAPGPGKGRGAKRKQQ
QQQEGSAAGATKRTRSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLEL
DCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVTGEKGYSMVRASHGVRKGA
WFFEVTIDDMPPETAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSMGKHYSSGY
SQGDTLGFFIELPDATETARSLPDTYKDKALIKFKSYLYFEEKDYVDKAEKNLKAVSPSR
MIFFKNGASQGVAFENLFEGLYFPAISLYKSCTVSVNFGPHFKHPPKDLKFQPMSDMGWG
AVIEHTLADMLYHVETDVDGRRSPPWEG
Download sequence
Identical sequences H3D7U8
ENSTNIP00000016589 ENSTNIP00000016589 99883.ENSTNIP00000016589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]