SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016597 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016597
Domain Number 1 Region: 201-327
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.24e-30
Family Pentapeptide repeats 0.0012
Further Details:      
 
Domain Number 2 Region: 88-189
Classification Level Classification E-value
Superfamily POZ domain 8.44e-28
Family Tetramerization domain of potassium channels 0.012
Further Details:      
 
Domain Number 3 Region: 2-81
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.0000165
Family Doublecortin (DC) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016597   Gene: ENSTNIG00000013598   Transcript: ENSTNIT00000016811
Sequence length 338
Comment pep:known_by_projection chromosome:TETRAODON8:4:3263699:3266365:1 gene:ENSTNIG00000013598 transcript:ENSTNIT00000016811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRVTLFVNGTTANGKVVAVYGSLDDLLSVASSKLGIRASSVYNGNGGLIDDISLIRDDD
VLFISEGESFEDPQEDLSGPERRQTHTDWLTLNVGGRCFTTTRSTLVSKEPESMLAHMFR
EKDVWGNKQDAQGAYLIDRSPDYFEPILNYLRHGQLIINEGINPLGVLEEARFFGIEQLA
EQLETLIKSSQPPDDHSPLTRKEFIRFLLATTTKSELRCQAANLQGVKMLCTNAEGASLR
GCNFEDPAGIKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTDLE
NCDLSGCDLQEANLRGSNVKGAIFEEMLTPLHMSQSVR
Download sequence
Identical sequences H3D7V6
ENSTNIP00000016597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]