SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016617 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016617
Domain Number 1 Region: 1054-1220
Classification Level Classification E-value
Superfamily C-type lectin-like 1.85e-70
Family Endostatin 0.00000546
Further Details:      
 
Domain Number 2 Region: 8-196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.47e-33
Family Laminin G-like module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016617   Gene: ENSTNIG00000013618   Transcript: ENSTNIT00000016831
Sequence length 1220
Comment pep:known_by_projection chromosome:TETRAODON8:6:6893875:6905057:-1 gene:ENSTNIG00000013618 transcript:ENSTNIT00000016831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTELIGVPLPPSVSFVTGFEGYPAYSFGPDANVGRLAKSFIPDPFYYDFAITVTAKPTTG
RGGVLFAITDAYQKIVHLGVGLSEVEDGSQRVALYYTDPGTTGGTQEAASFKMGDLTGRW
ARFTLTVQGSEVRLYMDCEEYHRVDFSRSPRPLTFEAGSGIFVGNAGGTGLTRFVGSIQQ
LVLKSDPTAPDDQCEEDDPYASGYGSGDNTYEDMEGADEVKKTVEERPLSGMEPTSSAPV
QAPPTELFPGYLETDDEDLQETSGQGMDTTTVQGKETDIRDRFRIRVASSLLLYSLDQPL
GGGKREPSPGQKGQPGEPGSLDPPGAPGKVHPGQPGAPGKAGRPGNKGEDGLPPGPSGPP
RLPGLKGEPGVKGEKGEPGFGLPGPPGPPGLPGRPSESLISEGSGFEDVDTDDETIRVGE
GVPGPRGPPGPPGPPGEPLEVIVSGPPGFPGKDGKDGEKGEPGLPGVDGKDGEPGPAGEK
GVKGQPGLTGQAGPKGDQGPPGFPGLQGPEGQPGPRGPPGPPGPPGPPVPLGRTFTTDLE
DLEGSGMNDFGVSRGPQGPPGLPGLKGSKGDDGTDGVAGKPGLKGEPGVAGSPGLPGWEG
QKGEEGPTGAKGEPGPKGEAGRDGLSFPGPPGPPGPPGPTINLQDVSDVAEIKKEKKPKN
HLMRQGPTGPKGDMGIPGVQGPPGLKGEKGEPAHFIAENGSTVTGPIGPKGLKGDAGLPG
PAGIQGPVGPAGPKGELGFPGRPGRPGPMGAKGERGDSGGPPGPPGPPGRPDFSSSAFRR
RCFPSVPGLTAKWPVGPKGEKGERGPPGMPAESQITRGSMDLDKTASQGARGDQGAKGEK
GDKGDAGLPGRPGIPGRPGLVGPKGESALGPQGPPGVPGSPGAPGLGRTPGRPTRYASAL
TIAGPPGPPGPPGPPGNGATSKTFSSRESMMRQTSRDPEGTIFYVTSTGGLYLKVPQGWK
EIQCESATLTRCALSRPAARQPDLRLRQHRSTRFDRPTRHVVLASSCLSDERRDVGKDQF
SLSTSESETRTQIRELWKVPAVVTEVPVLALTLQLHLVALNQPHSGDMTGPDAADRMCHE
QAEAMGLPPNYRAFVSSHRRDLVHAVYPGFRETLPVTNLRGDVMFRNWRSIFNGDGGPIG
ARVPVYSFDGRDVLADPFWPQKSIWHGSTGTGTRVTDKHCETWRTDHVSVAGQSSSLAAG
LLLGQQPRSCSNQYIVLCIE
Download sequence
Identical sequences H3D7X6
ENSTNIP00000016617 99883.ENSTNIP00000016617 ENSTNIP00000016617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]