SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016630 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016630
Domain Number 1 Region: 115-387
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.61e-70
Family Protein kinases, catalytic subunit 0.0000000028
Further Details:      
 
Domain Number 2 Region: 380-437
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000144
Family SH3-domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016630
Domain Number - Region: 962-1005
Classification Level Classification E-value
Superfamily UBA-like 0.00907
Family UBA domain 0.02
Further Details:      
 
Domain Number - Region: 7-70
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0174
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016630   Gene: ENSTNIG00000013631   Transcript: ENSTNIT00000016844
Sequence length 1011
Comment pep:known_by_projection chromosome:TETRAODON8:6:6630648:6635708:1 gene:ENSTNIG00000013631 transcript:ENSTNIT00000016844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQCEEGTEWLLELLTDVQLQHYFLRIRDELNVTRLSHFDYVKNEDLEKIGMGRPGQRRLW
EAIKRRRALYKRKSWMSKVFPGKRPDADTQQALPQGATAGSAAGGESGASLTCLIKESEL
QLFERLGDGTFGVVRRGEWTSPSGGVLTVAVKCLKANVLDSDGLDDFIREVNAMHSLSHQ
NLIRLHGIVLTQPMKMVVELAPLGSLLDRLRKRQGHILISSLCTYAVQVACGMSYLEQKR
FLHRDLAARNVLLSTNETVKIGDFGLMRALPTHTDQYIMEEGHKIPFPWCAPESLKSRTF
SHASDTWMIGVTLWEMFTHGQEPWLGLNGSQILHKVDVEAERLCKPEDCPQDTYNVMLQC
WSPKPEDRPTFVALRDFLLETMPTDMRALQDFEEEDKLQIKMNDVITIIEGRAEHYWWRG
QNRGTLRVGQFPRHVVTSVAGLSAQDISRPLKHSFIHTGHGDTDPHRSWGHADHIDSLYL
GNPMDPPDVLGMDPGIARPTKLPNRAKKQAPPRPPLPAVLLKKPFYDSVMDDYEDEDDAG
ASAGAKRLGVSLGLRLRPWDAGVRSATSEVSLIDFTDDSFSSNTPSPLTESRQPDQDTLK
VRLGLSIHSSASAALGRLHQDAPSILDWPLPQPAYDEVAAELEDQSEDQEVRSIYRALTE
TEDTASTAGAATACRAESQSADLFQELQREVMVKLQVPMATGRSLPSSPLPCLEEKPVLP
PRSPAPPLRPSKNSLSGRSASFQACSISGLLEQEDTPPQIPPRRRAYGLLGPLESPASSS
PPRLSAQPFQGTAQSPSYSSGSLLEPLPYREGRGLSALIDSPQSSASHPRPDRPAFSESL
SQFHPDDPGRPSASGSRSDWPLPTLLPAPVLRYGAANMAAVRPMMQQPGRAKPNPSHQGR
SAAPSVHQELSITQVPAAISPAPLQINAVPYSSASRVHRAVHGVTLQECRAALQTHSWSI
PQAVSHLKVEQLFRLGLRSRGECEELLQRCNWNLEESSSLVLDSVGSHGNM
Download sequence
Identical sequences H3D7Y9
ENSTNIP00000016630 99883.ENSTNIP00000016630 ENSTNIP00000016630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]