SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016662 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016662
Domain Number 1 Region: 302-423
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-26
Family Cadherin 0.0036
Further Details:      
 
Domain Number 2 Region: 82-190
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-25
Family Cadherin 0.00042
Further Details:      
 
Domain Number 3 Region: 191-307
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-23
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 411-519
Classification Level Classification E-value
Superfamily Cadherin-like 1.08e-19
Family Cadherin 0.0018
Further Details:      
 
Domain Number 5 Region: 9-89
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000209
Family Cadherin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016662   Gene: ENSTNIG00000013662   Transcript: ENSTNIT00000016876
Sequence length 723
Comment pep:known_by_projection chromosome:TETRAODON8:6:6170233:6197798:-1 gene:ENSTNIG00000013662 transcript:ENSTNIT00000016876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNRVIKLHSDVDKGDGKVKYVLSGEGATSIFTIDENTGDIHATKRLDREAQAYYTLQAQA
VDRLTNLPVEPRSEFVVKVQDINDNEPKFADGPYLAGVPEMSPIGTMVVQVAATDADDPT
YGNSARVVYSIIHGQPYFSVEPKTGVIRTALPNMDRETRDQYVLVIQAKDMVGQMGGLSG
TTSVTVTLTDVNDNPPRFSHKNYQYTVLESLPVRSVVAKIKAADADIGSNAEMDYRIMDS
DGLGVFNVTTDEDTQDGVITLLKPLDFETKSSFSLRIEAINRNIDTNFLNLGPFSDTTSV
KVTVQDVDEPPVFSAPLTNMVVSEDARVGTSIGKVSAYDPDTSNNGIRYTIDRHTDLERF
FNIDALSGVISTAKPLDREANSVHNLSILATETQNPEQIGKGITLVTVLDINDNAPVFAI
DYETLLCENTTPGQVIQSISAVDKDEPVSGHRFYFSLDPSVAGNPNFTLRDNKDNTASIV
TKRGGFRRREQPVYLLPVLITDNGSPALSSTNTLPVRVCECDSDGVALSCGAVAYTATGL
STGALLAILSCIITLLVMVLLIVTMRRRRKQPLILEEERDIRENIVRYDDEGGGEEDTEA
FDMVALRNLNAIRDPNIRRDVTPDTPTFYPYPPAPRPSFKALPDNLVFREFIWERLKDAD
VDPTAPPYDSLQTYAFEGSGSVAESLSSLESLSTDSDQNYDYLNNWGPRFQKLADLYGSS
DAA
Download sequence
Identical sequences H3D821
99883.ENSTNIP00000016662 ENSTNIP00000016662 ENSTNIP00000016662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]