SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016663 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016663
Domain Number 1 Region: 145-253
Classification Level Classification E-value
Superfamily Cadherin-like 1.15e-25
Family Cadherin 0.00043
Further Details:      
 
Domain Number 2 Region: 366-485
Classification Level Classification E-value
Superfamily Cadherin-like 9.03e-24
Family Cadherin 0.0026
Further Details:      
 
Domain Number 3 Region: 254-370
Classification Level Classification E-value
Superfamily Cadherin-like 3.66e-18
Family Cadherin 0.0044
Further Details:      
 
Domain Number 4 Region: 57-152
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000523
Family Cadherin 0.005
Further Details:      
 
Domain Number 5 Region: 475-582
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000602
Family Cadherin 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016663   Gene: ENSTNIG00000013663   Transcript: ENSTNIT00000016877
Sequence length 752
Comment pep:known_by_projection chromosome:TETRAODON8:6:6149560:6161058:1 gene:ENSTNIG00000013663 transcript:ENSTNIT00000016877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGRLEETTFLQMFRLLSLCIPGAAPSLSQNQRSALASSHAHRRLRRGWIWKQLFVPEE
DPTPQVIGQLRSDSDRGESSIRYILSGEGAGDLFQIDESTGEIWMLRKLDREEKASYVLQ
AQAINRRSSQPEELQSEFIITVQDINDNVPLFQNEPYESSIPEMCPLGTTVARVTATDAD
DPMFGNNAKLIYSILQGEPYFSVEPKTGIIVTSWPNMDREARDQYLVVVQAKDMLGLSGG
HSSSTTVTVSLTDVNDNGPTFQHHVYAFGVPENAAVGTTVGRIMAEDGDIGINAKMSYSL
EDSLEESGTFIIRTDPVTQEGVVLLAKPLDFETKRRFVLAAEAVNDYPDTRFLPLDKFRD
RMTLKIIVEDVDEPPVFLHPLYEWKVPENVVVGTAVGSVSARDGDAFDNPVRYSIDRRSD
AISAFRIDPNNGTVTVVQPLDRETSAWHNFSAEAKETAQGRLSSSVKLFIKVLDINDNVP
RLARDYQPYICEGTQPGEPVQLISAVDPDEPVEGHHFYFSMVPDRHINPNFTLRDNQDNT
ASVMARRSSFSRQDRSQYLLPVVLTDGGTALSSTSTLTISVCTCQPAGHCPSGGVRARSM
GVSLQSLIGLAVCLFTLTVLSVLLLLLRRHRRKQREALEVDTKELELELPDVLSQKVLYY
SPVGAEWAAVPLRPRPSRKERRLRREDVRASIRMSLRESHLIGPEDDVFRQFILERLAEA
DGDPCVPPFDRLRTYAYEGAGSPAGSLSSLDS
Download sequence
Identical sequences H3D822
ENSTNIP00000016663 ENSTNIP00000016663 99883.ENSTNIP00000016663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]