SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016666 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016666
Domain Number 1 Region: 5-60
Classification Level Classification E-value
Superfamily PX domain 0.0000000205
Family PX domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016666   Gene: ENSTNIG00000013666   Transcript: ENSTNIT00000016880
Sequence length 147
Comment pep:known_by_projection chromosome:TETRAODON8:6:6031066:6031937:1 gene:ENSTNIG00000013666 transcript:ENSTNIT00000016880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLMKIKEADDIEEKLNEVERLLKNAINMPCKYSRSEVMLTFFERSPLDQVLRNDKVHRIQ
PCFQSPVKISEIMRSNGFCLANTETIVDQSPPEEKDRPSSTDSVEHIYEDGGDFLLMESD
MCSQDTEAYVTNLSYYHLVPFETDILE
Download sequence
Identical sequences H3D825
ENSTNIP00000016666 ENSTNIP00000016666 99883.ENSTNIP00000016666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]