SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016672 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016672
Domain Number 1 Region: 841-941
Classification Level Classification E-value
Superfamily BRCT domain 7.12e-21
Family BRCT domain 0.024
Further Details:      
 
Domain Number 2 Region: 180-312
Classification Level Classification E-value
Superfamily BRCT domain 5.45e-18
Family DNA ligase 0.046
Further Details:      
 
Domain Number 3 Region: 488-590
Classification Level Classification E-value
Superfamily BRCT domain 1.57e-16
Family DNA topoisomerase II binding protein 1, TopBP1 0.067
Further Details:      
 
Domain Number 4 Region: 2-34
Classification Level Classification E-value
Superfamily BRCT domain 0.00000301
Family DNA topoisomerase II binding protein 1, TopBP1 0.008
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016672
Domain Number - Region: 969-1063
Classification Level Classification E-value
Superfamily BRCT domain 0.00929
Family DNA ligase 0.028
Further Details:      
 
Domain Number - Region: 121-154
Classification Level Classification E-value
Superfamily BRCT domain 0.0752
Family DNA-repair protein XRCC1 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016672   Gene: ENSTNIG00000013672   Transcript: ENSTNIT00000016886
Sequence length 1090
Comment pep:known_by_projection chromosome:TETRAODON8:6:5893559:5899171:-1 gene:ENSTNIG00000013672 transcript:ENSTNIT00000016886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPHVVTVQWLVDCFTKGCMLPEDGYLHPHCLPPGPAAVSVPVRQTSTSRLSTAPQVANQN
TPRNKQAEEDLLSQYMDDDPTVVDEALPAEGNDSTVLQPETGYNQSRGPEPDSTLPEGSM
AGLFFGKRFLLVGFGSEAEAQLSLLVTENGGRVLTGRPRIVADYAVVPLLGCSVEATVDE
VVTNTWLAMCVEKECVLQLSSNPLFTPVPVMYGCCPLKNCVLSVSQFTGAERESLVELAK
YLGAEVQDYFVRLATHKKGMHANTHLVLQSPEGTKYQAAKWGLPAVTSRWILESSRTGQR
APEERFLIDLPPSPATEKECESFVCGSQKISASSPARASPEIPLLGPQSGKTVTPLDLGR
FQSKVFCSMLNEVKPKDNTGTPQDAGHRNPQQKEASVQLDTPSRFLSKDQRFRPSFNLKD
AFDSPGGGSKPGQKVETPLTDVIQRNLKVVSASSTRTTSEMQAASASPQLPKTSETKVPA
KESGPLMGVVICVGKKLTKMQSDLNAIAASLGADFRWVCDDSVTHYIYQGRVGDSSREYR
GVKERGLHVVSQYWLHACAEEQRHVSESLYPFNYNPKMSLNLSQVPCSSQKSPNQTQRRE
TTVLKDKMIEPVTPEDAATACREGDGSKEEINDAQDKSMSESLAMRENLQRQLQAIMSAT
KMTTGRRASVRLSRRAVDSAPHTPETSWVGRNGNRRTLEALRVSREAAMDVNTEPSQSEQ
IVWDDPTAREERAKLADNLQWPSSPSQNSEPLQPPSTKETCPQFKDSMTDSELVEMAACD
VIDQQMGQKFTTHPTNDQENDVLTPKAPSTAFPLANPPVAPEPKVRRKYLPYEKKEDKQP
PRFLLSSLSPQERIDYSHLIEELGGVVLDKQSFDPSCSHIIVGTPLRNEKYLAAMAAGKW
ILHRSYLEACRSVGRFIQEDEYEWGSSSILDALPSITSQQRRLALAAMRWRKTLQGSRSE
HEVPGAFSGWTVMLNIDHSRDSGFRRLLQSGGAKVLPSPSPSLYREATHLFADFSRLKPG
DFRVDVSEATSHGVTCLKPEYIADYLMQEPTPSIQLYYLTEAPSAETPNTPSRKRKGEME
NSKLKKSRQN
Download sequence
Identical sequences H3D831
ENSTNIP00000016672 99883.ENSTNIP00000016672 ENSTNIP00000016672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]