SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016709 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016709
Domain Number 1 Region: 108-278
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.01e-36
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016709   Gene: ENSTNIG00000013709   Transcript: ENSTNIT00000016923
Sequence length 328
Comment pep:known_by_projection chromosome:TETRAODON8:13:11807965:11809510:-1 gene:ENSTNIG00000013709 transcript:ENSTNIT00000016923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPLPAEAVRELVRSCLHRDPVAADLRCSLFAAAAQSYKRDSLLRPFPPRYLRGDVKDF
DELLADVKSLPGVRELVRLPPRDGEHHLALAHWILSSKSFAVKTLQKVQFTNLFKLAENE
EVSAPVPDFLFELEYSDQMNARFQKTRAGREVFYAFHGSRLENFHSIIHNGLHCHLNKNS
VFGEGTYLTSDLSMALLYSPHSSGWQESLLGPLLSCVALCEVIDHPDVKCQVKKKDSELI
DRQRSRAKNSEGGEVPHKYFVVTNNQLLRVKYLLVYSQRRHLTRRSCSSSWLLRHHFAIM
MSLYLLLLIFIGAFNSNAFVSVWNKVFR
Download sequence
Identical sequences H3D868
ENSTNIP00000016709 99883.ENSTNIP00000016709 ENSTNIP00000016709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]