SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016714 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016714
Domain Number 1 Region: 420-528,562-611
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.6e-26
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016714   Gene: ENSTNIG00000013714   Transcript: ENSTNIT00000016928
Sequence length 633
Comment pep:known_by_projection chromosome:TETRAODON8:13:11850321:11854388:1 gene:ENSTNIG00000013714 transcript:ENSTNIT00000016928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQEAELMPSSESEEESEVEERVCGTQQEVQAADLHRHPQLDADIQAVRTFCPGAAVSVRE
YGSIDGVDVDLHINANSLDKEVREAWRIHPSEPIIIRLHFCCSQYVAGPAPSVEVFQPSN
RDHFNLGKQLKNILTDFISRQWNRVTNESIRTQEKSRQSWFNLRGTIKKVHASPNVWVPQ
SKSGDLQEASRREKVTLPAMKWNCFTNHSTSYIIKNSTGELFTYTPSGKRVMISAVKSPA
HLGTKQLVELLFSSQAIGHCKSTPTMEHGILVQIVRYAEQRIPTLSEYCVVCDEKHVFQS
GPVLKPAVCSRELCVFSYHTLGVMSGVTEEVATGAEVVDLLVALCRAALQSPRKSIIFEP
YPCVVDPNNPRTLAFSPKRKNYDRLQKALDSILLIRRMAQGPYSEIKMQMDKVDPLAHPL
LQWILASNRSHIVKLPPNRLKFMHTPHQFLLICSPPFKEACFQAARKRYGSTFAFHGSHF
ENWHSILRNGLVNGSYTKLQLHGAAYGKGIYLSPVSSISFGYSEMGKGRHRMATKEELRS
NGEPRSKQKQQQPCAARFLYNRNLNCIALCEVITSKHLQKHGNIWVCATPDHVCTRFLFV
YENGQVGDAHINTQEAKIHHEIVQVVRSKFYMN
Download sequence
Identical sequences H3D873
ENSTNIP00000016714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]