SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016715 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016715
Domain Number 1 Region: 505-614,649-697
Classification Level Classification E-value
Superfamily ADP-ribosylation 4.03e-27
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016715   Gene: ENSTNIG00000013714   Transcript: ENSTNIT00000016929
Sequence length 718
Comment pep:known_by_projection chromosome:TETRAODON8:13:11850351:11854252:1 gene:ENSTNIG00000013714 transcript:ENSTNIT00000016929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESEEESEVEERVCGTQQEVQAADLHRHPQLDADIQAVRTFCPGAAVSVREYGSIDGVDVD
LHINANSLDKEVREAWRIHPSEPIIIRLHFCCSQYVAGPAPSVEVFQPSNRDHFNLGKQL
KNILTDFISRQWNRVTNESIRTQEKSRQSWFNLRGTIKKVHASPNVWVPQSKSGDLQEAS
RREKVTLPAMKWNCFTNHSTSYIIKNSTGELFTYTPSGKAPSQRVMISAVKSPAHLGTKQ
LVELLFSSQAIGHCKSTPTMEHGILVQPKRKCIRAAAAISNSSSEIFFVWDPSLPLNSSH
LLIVPSTPAPPAGHFVSPQNCLFLPGLLDFPLVCTDCIVDFLSDPVNIVLIKTVLFPPQI
VRYAEQRIPTLSEYCVVCDEKHVFQSGPVLKPAVCSRELCVFSYHTLGVMSGVTEEVATG
AEVVDLLVALCRAALQSPRKSIIFEPYPCVVDPNNPRTLAFSPKRKNYDRLQKALDSILL
IRRMAQGPYSEIKMQMDKVDPLAHPLLQWILASNRSHIVKLPPNRQLKFMHTPHQFLLIC
SPPFKEACFQAARKRYGSTFAFHGSHFENWHSILRNGLVNGSYTKLQLHGAAYGKGIYLS
PVSSISFGYSGIADICRLSVNKKSCRHGPASSVCRAQQQPCAARFLYNRNLNCIALCEVI
TSKHLQKHGNIWVCATPDHVCTRFLFVYENGQVGDAHINTQEAKIHHEIVQVVRSKSG
Download sequence
Identical sequences H3D874
ENSTNIP00000016715 ENSTNIP00000016715 99883.ENSTNIP00000016715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]