SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016727 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016727
Domain Number 1 Region: 1881-2131
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.6e-55
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 949-1299
Classification Level Classification E-value
Superfamily L domain-like 1.02e-51
Family Internalin LRR domain 0.01
Further Details:      
 
Domain Number 3 Region: 1327-1511
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.66e-23
Family G proteins 0.0045
Further Details:      
 
Domain Number 4 Region: 112-631
Classification Level Classification E-value
Superfamily ARM repeat 1.27e-17
Family Armadillo repeat 0.042
Further Details:      
 
Domain Number 5 Region: 2175-2387
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000114
Family WD40-repeat 0.044
Further Details:      
 
Domain Number 6 Region: 694-785
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000518
Family Ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016727   Gene: ENSTNIG00000013726   Transcript: ENSTNIT00000016941
Sequence length 2521
Comment pep:known_by_projection chromosome:TETRAODON8:13:12171373:12186353:-1 gene:ENSTNIG00000013726 transcript:ENSTNIT00000016941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNGEELEEQLRKLLVRLKSQQQERQLGTLIQILQDLLFLAHTDEAAELFEDKDVHVSLT
VALSSYASRRGVQQVGWSLLCRLMEICPGTLERLTAAQPAAEDSQVLPVHKLVLKVLSQH
GADCKVTMVGLRALALLLRSDAVPPLLLEDESEDVLGLVVQAMKVFPVNEEVLLHGCGAL
QVLLETVSEDHLVEFVENQDHVVVLAALQTFLDNPELLLRGLKVLLPLARPASNVEILMG
GVRCYSTVIAAMDAFPEVEDLQETACRLFRAFTLESYYNILVRNGVQRVAVRACLAFPGN
ARLQAAALSCLADLSENKAVAEQGLEAGEEEENRGVEQVEDMGLGWMEACCTALDLHAEE
PDVQEAASWAIERLLVHGAGPRPAEEDQEERTPVHRQLMAALLLHPKAPSVFQAATSAIS
TLIQQDGRTRAPLLSSGLHVNLVEMMKRHWTSAEVSISACRLLSLLFQGRPASLDELNMT
MSQILCTIKAHNFNPEVQLEALRASLVLLYPAVADPDMADVSLKVLKNQCVLEGAHTLYL
EVLNRFISSSAIQKSGLKVLSALADCSGAVDLLCQQGAIDTVLHTLQMFPGEREIHYWGF
TLLNYLVTKKKLSPMIVPVLASVLVASLVQYREDSEMTLKCFQVALRMLDASPRSAAELQ
RENFDRQIFQQLREDTADLCNYPLRKSVCLALFKMWSDSELRYAMLEKACQDGDATMAEC
LIELGADVNAKTKSESLLYQVCERGGPLELAELLVRRGAHEQHLRRALAVSVKRADGPAV
ILLLARLGLDHNSSALCLGGFRLGRLDAGWLGPLLAERRSARSLCRTSSKAVSLARFVQS
FQRSKSHSSVLRSPVDPCLTSGYISEESDDSNFSFVSVDDGQIPNEDMESDGEPPRLAHI
WSDSLPGVLSPEDPQALRRRQGRQRHPSPEVQPPHQRPGCVEAIRKIPTKRRHLSPPCPV
FRPADGPAALQKVQDRVRLLDLSANELDALSCLMDDGVVQQQLGHLLRLDLSHNSLQEFP
SSLCQSLSSLTRLDLQGNQLPSLPVELLTLQSLNTLNISRNCVGPQLTFDPAVSCPSLRH
LNLSFNKIAAFPHQLSGAGSQLEELCLEGNCIRELCVPLSLPEIKLLDVSKNSVETVSAD
FLTGCPKLETLNVSVNKISSLSHLPSKLTTLKLANNGFAEVSAAILGLPNLRSVDMRTNR
IAALPGPASWESCNLRELNFSQNRIGTLDLSGPVHRWARLEKLHLSDNQLSEIPPQIGLL
EGLNSLDVSRNANLHSFPDEMGKLGRLWDLPLDGLRLQLDLKLIGNKTKDIVRFLQQRLK
KAVPYHRMKLIVVGNVASGKTTLIQQLMKLKRSQLKSKSTSVGIDVQDWTIKDWDRKKMV
LNVWDFSGGEEFSGSHPHFLTSRALYLVVYNLSRGASQVDALKPWLFNIKAAAPVSPVIL
VGTHTDVSNELQLQACLTKIREELLSHQSFPAIRDYHMVSASEDSDALTKLRKAIAREVA
NFKIQGQPVMGQLVPDSYVELERQLLQERARVPPEFPVLRHREVLQLIQENQLQLEEAEL
PHAIHFLSEAGVLLHFDDPALQLQNLYFIDPQWLCHIISQKLTLKSCGFWEPPKGVIQRS
LVEKFLSETKCFPKSHMTQLFKLLEKFQIALPFGEDQLLVPSSLSKHRPVIELPHGENSE
VIVRLYEMPYFPMDFWSRQIIRLLEFSSHLLSGREKAVRPNRIYWRRGVYLSWSPDAYCL
VEAASVEDNPSSFVRITVPSSQKGRVLLGQVVDHVDSLLEEWFPGLLSTNMHGSGEALLK
KWALYSFEDGQEWSKVLLDDLCPHLDAGVLLQDEEQPGLALPLSQVAPDLVLSDQPAGLM
LDSAELSVDLSERLDNVLFPGGGGFGNVYRGVYRKEDVAVKIFNNHASELYVFRLLRQEL
VVLSRLRHPSLVALLAASTAARALVMELAPRGSLDALFQHENGGLNRKLQHRIALQVADG
LRYLHSAMIVYRDLKPHNVLLFNLKTDCEMIAKITDYGIAQHCCSMGVRSCEGTPGFRAP
EVARGNVAYNQQADVFSFGLLLYDLLTCGERISDGMKFPSEFDEIAVQRKLPDPVKHYGC
APWPGLQALMRDCLKESPQCRPTSAQVFDRLNSGEVLCLMRELAVPRVPSAECLALSGGC
TAWLGGGSSAQRRGSVTAVNLHTNAVTTEAIDTSPVLCLTTVQIPNQTSDWLVAGTQSGA
LVVLSSQDALTWHRLQSVRDAVTSLFFHLHPCRNQRKNYLLVGTADGTVTIYEDSVLKQE
DGRPVKTVTVGQLDTPVVCLGQSLHWQDSRCVWAGCGTKVLSFTADYDLGRSVDTRPSAE
FQQEQSWASEACVSRMVVDKHVYLSKAGSPLVEVWDKKSERMVDRIDCAHIIRRDSGGTT
EGSSSWARVKALLVQSAAALWIGTRGGYLLLLELSKHQPLQVIGPRCDSVRCMAPALIET
PNWKNVVLVLGRRLPQGRNQADEESVLMVWNGMLPMEAKDLKRHCHRREQVAVRMREQFQ
A
Download sequence
Identical sequences H3D886
ENSTNIP00000016727 99883.ENSTNIP00000016727 ENSTNIP00000016727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]