SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016728 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016728
Domain Number 1 Region: 4-333
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.75e-51
Family LacY-like proton/sugar symporter 0.056
Further Details:      
 
Domain Number 2 Region: 413-525
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000000000366
Family Glycerol-3-phosphate transporter 0.063
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016728
Domain Number - Region: 354-391
Classification Level Classification E-value
Superfamily Plexin repeat 0.0432
Family Plexin repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016728   Gene: ENSTNIG00000013727   Transcript: ENSTNIT00000016942
Sequence length 567
Comment pep:known_by_projection chromosome:TETRAODON8:13:12188398:12191619:1 gene:ENSTNIG00000013727 transcript:ENSTNIT00000016942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPSFVYVLAFFSALGGFLFGYDTGVVSGAMLPLKKEMNLSNLWQELLVSSTVGAAAISSL
SGGYLNGWLGRRICILIASFIFSVGGAILGLAPNKEVLLLGRVTVGLGIGIASMTVPVYI
AEVSPPHQRGQLVTINSLFITGGQFIASLIDGAFSYLRHNSWRYMLALSVVPAVVQFTGF
IFLPESPRWLLQKGQSQEARVVLSRIRGDQSIDVEYETIKTSIEEEEREAGGEDPVILRI
LRHGPTRRALMVGCGLQMFQQLSGINTVMYYSATILQMAGIRDDRLAIWLTAATSPNFVP
TLLGVWVDRLGRRKLTLGSLLGTGLSLALLAVGFLLSAQNSPSISLHPLDPENSTCSLYE
NCQPCMLDPLCGFCYRDNGTAVYDSSCVPVNQTYTNLAAWGRCSNQTGAAGEAFWAYNYC
PTSYSWLVLLGLLLYLAFFAPGMGTMPWTVNSEIYPLWARSTGNACSSGVNWIFNVLVSL
TFLHVAEFLTYQGAFFLYAGLVVLGLFFVLGCLPETQGLQLEDIESLFSGPLCSCGASSR
TNGQNVQYIRVKGSNYYLSESDASEVD
Download sequence
Identical sequences H3D887
99883.ENSTNIP00000016728 ENSTNIP00000016728 ENSTNIP00000016728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]