SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016730 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016730
Domain Number 1 Region: 9-402
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.58e-118
Family Motor proteins 0.00000105
Further Details:      
 
Domain Number 2 Region: 1275-1597
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.63e-37
Family Quinoprotein alcohol dehydrogenase-like 0.033
Further Details:      
 
Domain Number 3 Region: 970-1085
Classification Level Classification E-value
Superfamily Prefoldin 0.000000000785
Family Prefoldin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016730   Gene: ENSTNIG00000013728   Transcript: ENSTNIT00000016944
Sequence length 1614
Comment pep:known_by_projection chromosome:TETRAODON8:13:12193701:12214927:1 gene:ENSTNIG00000013728 transcript:ENSTNIT00000016944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTGQDESSVRVALRIRPQLAREKIEGCHICTYVMPGEPQVILGKDKAFTYDYMFDMDSQ
QDAIYTTCTEKLIDGCFEGYNATVFAYGQTGSGKTYTMGTGFDVNIPDEELGIIPRAVHH
LFKGIEERREAAQKQGRPAPEFKINAQFLELYNEEVLDLFDSSRDMKQKSHIKIHEDANG
GIYTVGVTTRTVSSEAEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHLCQVRVCASD
DRENETDNRVSNGNSEMDEYETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLA
LGNVISALGDRSKRASHVPYRDSKLTRLLQDSLGGNSQTVMIACISPSDRDFMETLNTLK
YANRARNIKNKVMVNQDKASQQISALRTEIARLQMELMEYKTGKRMAGEDGVESFSDMFH
ENSMLQTENSNLRVRVKAMQETIDAQRARLTQLLSDQANQALARAGEGGTEEIGNMIQGY
IKEIEDLRAKLLESESANEHLRKNLARASNRQSLYAGPGSFSSTALAPEKETSDIIELAK
KDLEKLKKREKKKKKRYCRWDCWLPVVKHRCEQTDISKEEALDNELEKGAETELLQREDA
EMEVQEDSDNMDVEESSDDSDSESDEKENFQADLANITCEIAIKQKLIDELENSQRRLHT
LKQQYEQKLMMLQCKIKDTQLERDRILHNMNSVESGSEDKARKIKAEYEKKLSVMNKELQ
KLHSAQKEHARLLKNQSQYEKQLKKLQMDVVEMKKTKVRLMKQMKEQQEKSRMNESRRNR
EIASLKKDQRRQEHQLKLLEAQKRQQELILRRKTEEVTALRRQARPTSGKVIRKVNLPEA
VQESPHRPPPSGRMYSSGNTAPNGTRFLFEFPIGRWNTFPNTHAVCVCRSSYRRTVGVYS
TRVARNKWQTLERRISGVIMQRMTISNMEADMNRLLKQREELTKRKEKVMRKKERLAKEG
PEAEKTALPLNEEMDALTANIDYINDSIADCQANIMQMEETKEEGETVDVSAVISSCTLA
EARFLLDHFMSMAINKGLQAAQRESQVKVMEGRLKQTEITSATQNQLLFHMLKEKAEFNP
ELDALLGNALQDLDGVSPENGDDSSSDESAQSPSADGTSLAADITKLCGESKARNKARRR
TTTQMELLYANSDSVLDAPTADFSSPMLPLAEAADGGGEVDSSGSSVRDYAALSPGFASK
MGSISGSRVSSGLEKREASPLSRRKTYDKAQAAAHRAKVKENKHTGADSDPSSCHSRTVR
GVINPVPSTKSGRSSTLQCVHVAEGHSKAVLCVECTDDLLFTGSKVPDRTCKVWNLVTGQ
EIMSLSGHPNVVSVRYSSSLVFTVSTSYIKVWDIRDSAKCIRTLTSSGQVTVGDVCSSSV
SRTVAIPAGENQINQIALNPNGTVLYAAAGNSVRVWDCGVRFASTGKLIGHLGPVMCLTV
DRSGTSSQDLVITGSKDHYIKLFDVAEGSLGSIGPTHNFEPPHYDGIESLVVQGDMFFSG
SRDNGIKKWTWTAKTCCRQVPNAHRDWVCALGVVPASPVLLSGCRGGVLKLWHTDTLGTL
GEVKGHESPINAISTNSSHLFTASDDRTVKIWRARGGLESTVEGADNAEEAASN
Download sequence
Identical sequences H3D889
ENSTNIP00000016730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]