SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016731 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016731
Domain Number 1 Region: 158-256
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.56e-22
Family Synaptotagmin-like (S variant) 0.024
Further Details:      
 
Domain Number 2 Region: 17-136
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.96e-21
Family Synaptotagmin-like (S variant) 0.022
Further Details:      
 
Domain Number 3 Region: 301-482
Classification Level Classification E-value
Superfamily vWA-like 6.39e-18
Family Integrin A (or I) domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016731   Gene: ENSTNIG00000013729   Transcript: ENSTNIT00000016945
Sequence length 558
Comment pep:known_by_projection chromosome:TETRAODON8:13:12219927:12247471:1 gene:ENSTNIG00000013729 transcript:ENSTNIT00000016945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFIGDADPFTAAIPATKVELTVSCRNLLDRDTFSKSDPICVLYTQGIANREWREFGRTE
VIDNTLNPDFVRKFILDYFFEERQNLRFDLYDLDCKSDNLSKHDFLGQVFCTLGEIVGSL
GGRLEKPLIGIPGKKCGTIIVRAEELSNCRESVMLQFCGNKLDKKDFFGKSDPFLVFYRS
NEDGSYTICHKTEVVKNTLDPVWQAFKIPVRALCNGDYDRSIKVEVYDWDRDGGHDFIGE
FSTSYREMSRSQSQFHIYEQEQNLLKVQESEKYQNSGTVTLLSCLVDTELSFLDYIRGGT
QINFTVAIDFTASNGNPSQPTSLHYMSPYQMNDYAMALRAVGEIIQDYDSDKMFPALGFG
AKLPPDGRVSHEFPLNGNPQNPYCSGIEGVMEAYYQSLKSVRLYGPTHFSPVINHVARYA
SAVTDGSQYFILLIISDGVITDMAQTKESIVNAASLPMSIIIVGVGPAEFDEMVELDGDE
ERISSQGRYAERDIVQFVPFRDYIDRRGNHILSMARLAKEVLAEIPDQFLSYMRTRGIKP
GPLPPPYTPCPSTAPERP
Download sequence
Identical sequences H3D890
ENSTNIP00000016731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]