SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016749 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016749
Domain Number 1 Region: 1034-1083
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000053
Family Laminin-type module 0.0029
Further Details:      
 
Domain Number 2 Region: 881-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000134
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 397-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 267-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000017
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 5 Region: 927-977
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family Laminin-type module 0.0066
Further Details:      
 
Domain Number 6 Region: 1143-1191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 7 Region: 334-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000106
Family Laminin-type module 0.042
Further Details:      
 
Domain Number 8 Region: 498-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 9 Region: 987-1036
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 10 Region: 1191-1237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000019
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1086-1140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 12 Region: 449-490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000128
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 13 Region: 833-874
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000628
Family Laminin-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016749
Domain Number - Region: 797-876,1249-1331,1522-1591,1696-1782
Classification Level Classification E-value
Superfamily ARM repeat 0.0178
Family HspBP1 domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016749   Gene: ENSTNIG00000013747   Transcript: ENSTNIT00000016963
Sequence length 1810
Comment pep:known_by_projection chromosome:TETRAODON8:13:12379541:12396151:1 gene:ENSTNIG00000013747 transcript:ENSTNIT00000016963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLIRLFLSLAHLQDLQDLQDLQDHCPDGFCNPSLGDLMVGRASQLSASSTCGLDGPENY
CIIGYLEEEQKCFTCDSRLPYNRYSNPNSHLIENVITTFEPERKLKWWQSENGVHRVSIR
LDLETVFQFSHLVLKFKSFRPAAMLVERSKDFGQTWKVFRYFAEDCLLHFPSVPNELANS
IDDVVCDSRYSGSEPSTDGEVVLKALDPVFEIEDPYAYNIQDLITVTNIRINFTRLFTLG
DTLLRKRRNPQDKYYYALYDMVVRGSCFCNGHASQCTPVDQGRGDTFSQPGMVHGRCVCL
HNTAGENCERCADFHHDSPWRPGGQKAADVCRRCNCHGHSESCHFDLARFEATGGVSGGM
CDNCRHGRTGPQCEHCQAKFYQDPQRARDHPQACIRCDCDLAGSKGGGLCDPLTGQCLCK
DNTEGQRCDRCKYGFFNLQPDDPNGCQECRCHVSGTVGSCDPVTGGCDCDPLAVGPLCDR
CLPGFWGLGNSLFRCSPCDCDLGGAQSTQCSPEEGQCRCLPNMVGRRCSDPAPGYFLPSL
DYFLYEAELAVPLHGGASPSTTDPPSSPLVRNKHKYALNMRAVPHRQRLNLGISPNCEQY
YRQQGYDFKLSNGRIVLVRRTARSARRRRQEQRGSIPLEPGHPLQIIPRQRTGGQPVTWT
GQGLVRVQDGAGLRFIVDNLPSSMDYQLVIRYEPEAPSDWDARVEITPVSLGDGRCASEP
TGRKALLLPGDSRAAVLDAPVCLNGGGRYFVDVVFDKQPDGTPSSPLLVDSMGLIPRIES
VQDFCSESDIDSFRRFRCVGLAAELSPQESLPESCEGLISSMSARINNGAVACRCNAVGA
LGPSCSKLGGVCDCKPNVIGRCCDACAPMTFGFGPDGCEACDCDPRGATSELCDQVRGQC
SCRLEVTGRRCDHCRTGYWGFPLCRPCQCNGLSEECDPHTGECWNCRQHAQGPNCDRCEE
GYYGDPVSRQPCEPCLCPDIQGSGRFFATSCHHEPQSLGLTCACREGHEGPSCDRCSPGY
YGNLALPGASCELCLCNNNIDLDDRNACDGVTGECLRCLHNTMGPQCQDCKPGYYGNALE
RDCKECSCDRRGTKVTQCPLGSPCFCDPSTGQCPCRKGVVGVLCDECEDGYWNMDGASGC
QPCSCDPANSLSYVCDKVTGQCPCLTEFGGQQCDECGENHFGNPDLQCVSCDCNLDGTER
PSCDPETGECMCRKGVTGIFCDECAPGHDSEFPACRECHPCHALWAEDVTDVQKASQVLK
KLIPHISDAIQPADNRLLQRVLDLQSKLDSLENLTALAPSAVEEVEELYEAIRNSNDTAH
PNLTLPDLSPLNQQIRKVRQEAEELLNKTRQKAAEHPCPTLELLDEINKLNNASMLDEER
VRNTNQTLEDSMNTRLEAELNLTACCGQGDLAPLERKVTGLSVVDLNRQICGGAGLDCSE
CGGARCFLNGRMKCGGPNCDGILPTSQNASETARRAANEMLTLPSRLEESKNKLNKAKQE
ALDSKQQAENMQDRLNATMDSFEMEKTKTKELIRRAKDFLLDDLVHPDDIEKMARAVLSI
RLPRSPEQIQSMIEEINNLLSNASRFQDDLKRLEEHTNITQELLRRAEDVKIRTKSIDVT
EIRRDIYLAEGAQDRANDDLEAASQDTDMTRNRIAESNNNLYHLEAKLMSQRPEDLSRRI
RDVQEKTEQNRRMAADAREAADAALQNATAVEQEMKNVTRLFEDLKQKNSSQTIQDEAGK
RLKNITDEVEKMKQAIEDKQRQIQELEDKILQLIKRKEEKAERVSEMVKEVESLRKEISS
RADAYVICTT
Download sequence
Identical sequences H3D8A8
99883.ENSTNIP00000016749 ENSTNIP00000016749 ENSTNIP00000000585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]