SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016756 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016756
Domain Number 1 Region: 257-581
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.67e-55
Family Diacylglycerol kinase-like 0.0075
Further Details:      
 
Domain Number 2 Region: 768-896
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-19
Family Ankyrin repeat 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016756
Domain Number - Region: 127-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0575
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016756   Gene: ENSTNIG00000013754   Transcript: ENSTNIT00000016970
Sequence length 908
Comment pep:known_by_projection chromosome:TETRAODON8:13:12586007:12595215:-1 gene:ENSTNIG00000013754 transcript:ENSTNIT00000016970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNNYKQIGLEMWSVCRKALTKTGLQHVGPQPALPTSGPTEQLQEPSSTIDWTDNAQFGEH
IWFETSGSGDFCYVGEQYCFAKSLQKSVARKKCAGCKISVHTMCMEQLEKINFRCKPSFR
EPGSRAIRESNVVRHHWVHRRRQTGKCRQCGKGFQQKFTFHSKEIVAISCSWCKQAYHNK
VTCFMLQQIEECCSLGAHAAVIIPPTWIIRVRRTQTSLKSSKKKKRASVKSSKSSKKGVE
DGRWKPFLVKPLPSQLMKPLLVFVNPKSGGNQGAKIIQSFMWYLNPRQVFDLTKGGPSEG
LELYSKVPNLRILACGGDGTVGWILSVLDQLKLRPQPPVGILPLGTGNDLARTLNWGGGY
TDEPITKILSHVEDGNIVQLDRWNLNVEPNPEARPEDMDEHQTDKLPIDVFNNYFSLGFD
AHVTLGFHESREANPEKFNSRFRNKMFYAGTAFSDFLSGSSKDLAKHIKVVCDGTDLTAK
VQEMKLQCLLFLNIPRYCAGTMPWGHPSEHQDFEPQRHDDGCIEVIGFTMTSLATLQVGG
HGERLHQCKEVTLTTYKSIPMQVDGEPCKLAPSVIHINLRNQANMVQKAKRRISMPHLND
QQPVPEKLQIRVNRVSMAAYEALHYDKDQLKEASTPLGVITVPGDSDLETCRLLIERLHD
NLDQDCDDVRRESLSSQSLSKKWCFLDCTTADRFYRIDRAQEHLNYVTEISQEELYILDP
ELVVKETVGTSPSMPDLPRPTSPGLPSAGCNNCDKNVKTDTRDAKAKYAELINCIKTEDL
ARLMELHQQAADILLQDAAGCTLLHHAVEAGSKEILKYLIDNDLVPTSHLDITERETGET
ALHKAASSCQRSICHCLVEAGASLVKTDLQGETPKQRAEKANDPELADYLENHQHYQTIQ
REDQETAV
Download sequence
Identical sequences H3D8B5
99883.ENSTNIP00000016756 ENSTNIP00000016756 ENSTNIP00000016756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]