SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016767 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000016767
Domain Number - Region: 9-54
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0759
Family Second domain of FERM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016767   Gene: ENSTNIG00000013765   Transcript: ENSTNIT00000016981
Sequence length 428
Comment pep:known_by_projection chromosome:TETRAODON8:1:10469679:10474014:-1 gene:ENSTNIG00000013765 transcript:ENSTNIT00000016981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGPFSRGFFRKLLYVQARFSYLHMKYLFLSWLAVFVGSWVVYVEYSSYTELCRGRECK
NSICDKYRRGLIDGSACSSLCEKGTLSLGTCFSARAKSQVYTGSWGDLEGVIKCRMEEAQ
RYDLENQVEPRKKAAGFDQPSRGTSVEKFREMILDHLKSKVGDQANLADLAAQVLSMTDA
NKDGHISLPEAHSTWALLQLNEFLLALVLQDREHTPKLLGFCGDLYVTEKVPYSPLYGVG
LPWILEVWIPASLRHSMDQWFTPSWPFKAKISIGLLELVEDVFHGTFGSFLMCDVSAGSF
GYNDRHDLKVTDARYIVPEAVFQEDIRQQRCDDDRDCRFGADCLTSCDLTKHRCTTEVTR
PNLAKACETMKNYVLRGAPPDVREELEKQLYACMALKGSAEQMEMEHSLILNNLKTLLWK
RISHTKDS
Download sequence
Identical sequences H3D8C6
99883.ENSTNIP00000016767 ENSTNIP00000016767 ENSTNIP00000016767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]