SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016769 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016769
Domain Number 1 Region: 31-782
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.23e-274
Family Motor proteins 0.000000000144
Further Details:      
 
Domain Number 2 Region: 1965-2055
Classification Level Classification E-value
Superfamily PH domain-like 1.27e-19
Family Third domain of FERM 0.023
Further Details:      
 
Domain Number 3 Region: 1848-1964
Classification Level Classification E-value
Superfamily Second domain of FERM 4.84e-19
Family Second domain of FERM 0.0072
Further Details:      
 
Domain Number 4 Region: 1748-1857
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.35e-19
Family Ras-binding domain, RBD 0.09
Further Details:      
 
Domain Number 5 Region: 1153-1256
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.05e-18
Family First domain of FERM 0.093
Further Details:      
 
Domain Number 6 Region: 1248-1341
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000576
Family Second domain of FERM 0.014
Further Details:      
 
Domain Number 7 Region: 786-854
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000149
Family Motor proteins 0.044
Further Details:      
 
Domain Number 8 Region: 1475-1530
Classification Level Classification E-value
Superfamily SH3-domain 0.000000827
Family SH3-domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016769   Gene: ENSTNIG00000013767   Transcript: ENSTNIT00000016983
Sequence length 2065
Comment pep:known_by_projection chromosome:TETRAODON8:1:10491249:10504833:1 gene:ENSTNIG00000013767 transcript:ENSTNIT00000016983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVSMKGDFVWLDSGSGVPIGAEVKVTDAGQLYLIDDDGKEHKVNKKVTLRSMHPTSVKGV
DDMIRLGDLNEAGLLRNLLVRHKEGIIYTYTGSILVAVNPYQLLPIYTIEQVQMYTDRRL
GEMPPHVFAIADNCYFNMRRNRKNQCCVISGESGAGKTESTKLMLQFLAAVSSQHSWIEQ
QVLEANPILEAFGNAKTIRNDNSSRFGKYIDISFTDAGAIEGARIEQYLLEKSRVCRQAP
EERNYHIFYYMLAGMPAEKKKSLSLGKASDYNYLTMGKCTNCEGREDVMEYSHLCSALKI
LMFSEDDSWELFKLLAAVLHLGNIKFEGTMENNLEVCTIVKSSHFSMASQLLEVDSKELE
KSLSQRSFMTATDSVSKALTSVQAMDGRDAFVKAIYGRLFIWVVDKINTVIYTQREESDD
PQQTIGLLDIFGFENFDKNSFEQLCINFANEQLQQFFVKYVFRLEQEEYAQENIVWTRID
YQDNQKILDTLAIKPLNLLALIDEESNFPKGTDTTMLQKFDQAHGTGNVYVPPKNSYETQ
FGIQHFAGIVHYDSKGFLEKNRDSLSSDLIQLVQKSTSKLLKQAFCDALSQNVDAKKRVP
TLIGQFRKSLDSLMKTLTSCQPFFIRCIKPNDFKKPMLFNRELCNSQLRYSGMMETIRIR
KAGYPVRYTFDEFLGRYRVLLKAHLRDPQTESKKKCCQSICETVLRKQEDWKTGKTKIFL
KDRHDTMLELERMKQLDVKALIIQRVLRGYKYRREFLRKRASAVVIQKYWRGHKSRKLLQ
VIQHGFARLQAQICSRQMQLQYRRKREAAIVLQAQLRGHLARKEWKHKRDAVIVLQAHTR
GMLARRALKKTKRDASSPAGVVCKKLAQMFLSAKQKEEEQRLLLERQAYLEEVLRQARET
EAKARADAITDQEIVDSFFDFLPVMSGERESPDSAYFCCQNIEKRMGMEEIDIDDLPMED
DRLSEEDDLDEYSFSKFASMYFQGAATPTHIRQKLRQPLLYHEDEGDVLASLTVWWIILR
FMGDLPEPKKQVQETSSKERDGPTLDRPLTSLEKLHIIVGYAIVRSDLRDEIYCQICKQL
QDNNNRTSYFRGWILLSLCLGIFPPSEKFLKYLQSFIRFAPGGFTTYCAEKLRRTGMNGV
RGEPPAWLELQATKTKKPIVVSVTLMDGRAVSLPVDSASTSKEICHLLANKINLTDQFGF
SLYVTLYEKVLALGCGREHLMDAISQCEQEVKRRGGQEQHAPWRLSFRKEIFTPWHDCKE
DKISTQLIYKQIIHGLNFGEYRCPKEDDYVQLTAKHLYIQHGADSSPENVKEAVKDCINA
SRLKARSEAKWVQMVSTAHAQGSYLSSKQKADAVKAEMVDYTRETWPMLFSRFFEVTKVS
GPPLPKSSFIVAINWTGITFLDEKERRLLELSFPEVMGVNTIRDGKGQAASLLTLKGDFT
LSGASAEDMTELITMFLSGLTERSRFAVTLREAETQDDPTFLSFKKGELIVIIRDDEYPQ
QRGWIKGENNRTKKKGAVPTDAILILPTLSKPTNEVMRLLTLSPNQRKNVVQANQKETGT
VERLAPATLKEFSLIYFRQPTKDVNRQVISRNAAPEKLWVCSREPIRQPLLKKLVGNPDL
SHKACLAFTAILKYMGDYPTKQLQSPIVLTDQIFGPATKYEVLRDEIYCQIMKQMTNNNN
RLSMELGWQLLWLCCGLFPPSQALLKHAHRFVESRRREPLASDCLKRMQSLLRLEPRKLQ
PHLVEVNAIQLNSTQILHKVHFPNDTDEVFEVTSTTRVRDLIQSIVRKLSLASAEGYSVF
IKTHNKVLSLNEPEYFFDNLRQITDWSEKMTRIKDIGSVNTPYDVFFMRKLWFNVVPGKD
AKADLILHFPQELPKYLRGYHACSREEMIHIAALLFRIKVNNDRSQFATIPKMLKELVPP
DQLKTLSENEWKKLIVATYNKQGKMTIEEAKAAFLKAVYRWPTFGCAFFEVKQTSEPSFP
DIVLIAIGKLGLTISHPKTKEVLATHPFNRIANWSSGSTYFHMTIGSLVKGKKFLCETSL
GYKMDDLLTSYVNMYLRDRRALQTK
Download sequence
Identical sequences H3D8C8
99883.ENSTNIP00000016769 ENSTNIP00000016769 ENSTNIP00000016769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]