SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016789 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016789
Domain Number 1 Region: 9-173
Classification Level Classification E-value
Superfamily RUN domain-like 3.92e-49
Family RUN domain 0.000000136
Further Details:      
 
Domain Number 2 Region: 537-603
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.82e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016789
Domain Number - Region: 328-447
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0122
Family Myosin rod fragments 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016789   Gene: ENSTNIG00000013787   Transcript: ENSTNIT00000017003
Sequence length 607
Comment pep:known_by_projection chromosome:TETRAODON8:5:3720246:3725606:1 gene:ENSTNIG00000013787 transcript:ENSTNIT00000017003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AALRDPMTMERANLLNMAKLSIKGLIESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKV
KKSFLGFNKSLWGPLELVEKLCPEAAEISASVRDLPGLKTPLRRARAWLRLALMQKRLAD
YLRLLITRKDLLSDFYETSALMLEEEGAVIVGLLVGLNVIDANLCVKGEDLDSQVGVIDF
SLYLRNDVDDYRGNRNSQIASILDQKNYVEELNRQLNSTVHGLQGRVGSLEKSNLSPLGQ
LAIAKNNIIKLQEENQHLRSENSLILLKSQQQLEVTQGDVSVERDTYKQSRQGLDEMYNE
ARRQLKEECQLRQDVENELVAQVSMKQEMELAMKLLEKDIHEKQDTLIGLRHQLDEVKAI
NVEMYQKMQASDDEMKKKNNMISRLEEKTNQITATMKQLEQRLQEAERHRGSAEEGTRRF
KLDFANKADSLQRRIEHREKQLQQLETDLKIERQWRQTLQKDLDREKDTVAQLSTEALQI
SALKKEFHRLQDENLQLKSVCGDQEQALEELGSKLSESKMKIEDIKEANKALQGGQVWLK
DKDASRCKLCEKEFSISRRKHHCRNCGEIFCNGCSDNELPLPASPKPVRVCDTCHALLLQ
RCSSNAT
Download sequence
Identical sequences H3D8E8
99883.ENSTNIP00000016789 ENSTNIP00000016789 ENSTNIP00000016789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]