SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016797 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000016797
Domain Number - Region: 41-160
Classification Level Classification E-value
Superfamily E set domains 0.00273
Family Arrestin/Vps26-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016797   Gene: ENSTNIG00000013795   Transcript: ENSTNIT00000017011
Sequence length 328
Comment pep:novel chromosome:TETRAODON8:5:3801599:3803987:-1 gene:ENSTNIG00000013795 transcript:ENSTNIT00000017011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSFLGGLFGPVCEIDVLLNDAENRKTAELKTEDGKVEKHYLFYDGESVSGKVNLNVKQGG
KRLEHQGIRIEFVGQIELFSDKSNTHEFVDLVKELALPGELTQNRSYDFEFMQVEKPYES
YVGANVRLRYFLRVTIVRRLSDLVKEYELIVHQLATYPDVNNSIKMEVGIEDCLHIEFEY
NKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETVAKYEIMDGAP
VKGESIPIRLFLAGYDLTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIVLWRKAPE
KLRKRNFHQRYESPEPPTQPVNAEQPEM
Download sequence
Identical sequences Q4S0Z5
ENSTNIP00000016797 99883.ENSTNIP00000016797 ENSTNIP00000016797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]