SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016801 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016801
Domain Number 1 Region: 818-933
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-34
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 2065-2173
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-33
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 3 Region: 1888-2007
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-32
Family Spermadhesin, CUB domain 0.00077
Further Details:      
 
Domain Number 4 Region: 1-109
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-30
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 5 Region: 650-757
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-30
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 6 Region: 178-280
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-29
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 7 Region: 2232-2346
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-28
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 8 Region: 2418-2522
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-28
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 9 Region: 479-590
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-28
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 10 Region: 1343-1454
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-27
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 11 Region: 1177-1280
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 12 Region: 991-1112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-25
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 13 Region: 1715-1825
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.33e-22
Family Spermadhesin, CUB domain 0.005
Further Details:      
 
Domain Number 14 Region: 2829-2898
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.72e-19
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 15 Region: 2772-2840
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.59e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 16 Region: 3013-3082
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.64e-18
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 17 Region: 3191-3259
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.98e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 18 Region: 3130-3201
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.35e-16
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 19 Region: 3310-3378
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000445
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 20 Region: 416-487
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000514
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 2006-2070
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000082
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 22 Region: 3071-3135
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000001
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 23 Region: 2178-2247
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000121
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 24 Region: 2947-3007
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000175
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 25 Region: 2523-2596
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000361
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 26 Region: 1552-1649
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000497
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 27 Region: 1282-1348
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000005
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 28 Region: 939-999
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000985
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 29 Region: 764-833
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 30 Region: 2888-2955
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000215
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 31 Region: 114-174
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000256
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 32 Region: 2713-2776
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000264
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 33 Region: 3242-3304
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000612
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 34 Region: 1832-1896
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000709
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 35 Region: 2349-2412
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000917
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 36 Region: 3369-3427
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000167
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 37 Region: 594-649
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000542
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 38 Region: 2585-2652
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000639
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 39 Region: 1112-1173
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000148
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 40 Region: 2665-2720
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000167
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016801   Gene: ENSTNIG00000013799   Transcript: ENSTNIT00000017015
Sequence length 3665
Comment pep:known_by_projection chromosome:TETRAODON8:5:3896836:4072965:1 gene:ENSTNIG00000013799 transcript:ENSTNIT00000017015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCGGVVQGLNGTIESPGFPHGYPNYANCTWLIITGERNRIQLTFVTLALEEDFDIVSVYD
GQPSPGNLKMRLSGFMLPSPIVSSGSILALWFTTDFAVSAQGFKAVYEVLPSHTCGTPGL
IPNGVSHGSRYNIGDKIRYSCESGFVLEGHSILTCIVSPGSGAQWDFPSPFCRAEGACGG
TLRGTAGSITSPGYPAEYDNNLDCTWSILSEPGDTIALVFNDFLLEDKYDFLEISGTEAP
SIWLTGTALPSPVISSKNWLRIHFTSDSNHRRKGFSAQYQGSASFHTAPTPNVPSRNRSK
IMPKGQGAAERSCALSKCFSTFVIAVNSTVILWTYRNELTAPNTKHHGPGSCRLCDTSVI
TFLIFLSNFCQTHKFLSFSTVKKAIELKSRGVKMMPSKDSSHKNAVLSQSGLAGDVCPDP
GVPENGKRMGSAFQVGSSVQFNCDDSYVLQGSKSITCQRVTDTLAAWSDHRPICRTRTCG
SNLRGPKGIITSPNYPVQYENNAHCVWVITAMDSGKVIKLSFEEFDLERGYDTLTVGDGG
KIGDTRRVLYVLTGSSVPDLIVSLSSQMWLHLQSDDTIGSAGFKAEYEEIDRGGCGDPGV
PAFGRRSGDLSNGDVLTFFCQPAFELVGERTITCQHNNQWSGNKPSCVFSCFFNFTAPSG
TILSPNYPEEYGNNLNCVWLIISEPGSRIHLLFSDFDLEPQFDWLVVKDEGLSEMTTFGT
FSGKDVPSQIASNGHIMRLEFQSDHSNTGKGFNISSTTFGQNECHDPGVPVNGQRYGDQF
QLGSSVAFRCDHGFIRTQGSDQVTCIIQDGNVVWSAAVPRCEAPCGGHLTANSGVLHSPG
WPSFYKDSLNCQWVIEAQPGHAVKIHFDRFQTEVNYDTLEIRDGPSASSPLIGEYHGTQA
PHFLISTSNVLFLLFTTDNSRSAAGFNIRYESVKMESDSCLDPGIPVNGRRHGSSFSTGS
SVSFTCEPGYTLSDQEPIVCEQNHQWSHALPSCDALCGGYIYGKTGTILSPGFPDFYPNS
LNCTWTVEVSHGKGVHLVFHTFHLEENHDYLSITEDGNFQVPVARLTGSVLPPSVKAGLF
GNFTTQLRFISDFSMSYEGFNITFSEYDLEPCEDPGVPAFSRRTGFRFRVGDSLAFSCFH
GYRLEGGSKITCLGGGRRVWSNVLPRCIAECGASSQGPEGVLLSPHFPSNYDNNHECIYR
IMTEKGKGIRLKAESFFLQDGDYLKVYDGENTSSRLLGNYTRDDMVGQVVNSTSNRLWLE
FNSNASGTNQGFRLAYTSFDLVRCEEPGIPSYGYKIQDDGHFANTHVLYSCNPGYSLHGS
STLTCLSGDRRVWNKPLPSCIAECGGHITGAVSGRILSPGYPAPYDNNLHCTWIVEADTG
KTISLHFIVFDTEVGHDILRVWDGSSGPSDGGILLKEWSGQALPEDIHSTFNILTLQFDS
DYFISKQGFSIQFSNMIAQVCEAPQCCVTSGSLLWGKPAGSHRWIYFVVFLRCHSFIFQL
SKSVLGRWEVQNRYQDSFLTKWLLNPSICLMPLSSCSFLSFFLITFSLYFTLSPTFPYTY
PFTLDPLRSMTLNGTFSQIFDLNFLPSFNMEPSYDFLHIYEGEDSNGPLLASLQGNQAPE
RIESSSNSLFLAFRSDASLGMSGFAIEYRGSSNLEICDKSGKLGMTSTQLCLQFKNIGSD
ISFYCGCRYLFMLIFELSCDPELCTWERASERSKAPCGGQYGGSEGVVLSPNFPLNYTTR
QICSYYITVSPQFVVFGQFAVFQTAMNDSVELFDGANENSRLLSSLAGSHSGETLPLATS
NQIMLRFNSKSGQSARGFHFVYQAVPRTSDSQCSSVPEPRYGRRIGSEFSASSVVRFECS
PGYLLKGSSAIQCQAMPGALAQWNATAPTCIVPCSGNLTERRGTILSPGFPEPYPNSLNC
LWRIHVSEGAGIQIQVITFATEHNWDSLEIYDGGDMTAPKLGSFSGTTAPALLNSTSNQL
LLHFQSDISVVAAGFHLEYKTVGLTTCPEPMIPANGIKTGERFMVNEVVAFSCEPGYTLQ
GHSHITCMPGTVRRWNYPPPLCIAPCGGVLSEMSGVILSPGFPGNYPGNLDCTWQIRLPT
GYGAHIQFQNFSSEDNHDFLEVRAGPQHSSALIGKFTGTEIPPTLLSTTHLTTIHFYSDH
SENRPGFKLNYQAYQLQDCQDPSPFPNGDIINSDYSAGQSITFQCYPGYVLIGHPVLTCL
HGSNRKWNHPFPRCEAPCGYNVTAENGTVYSPQYPNEYPNSQDCSWLITVPHGHGVYINF
TLLQTEPEADYITVWDGSDMSSPQLGVFSGNTALGSAYSTSQKALIQFHSDFSTGGSFIL
NFHAYCLKKCPPPPDVENAELFYEDEDFQIGDIVRYSCLPGYTLVGKSELTCQLNSLLLF
ETPTPACQAQCPANEERTSSSGVILSPGFPGNYPNSQTCSWLLHMIPGYTINIYVELFHS
EKQFDELEIFDGSSGQSPLLVALSGNHSSQLNFTSKTNQLYLRWSTDHATNKRGFKIRYS
AAYCSINDPPLNGGVINRTKLRPGSRLLYYCNRGYRLVGSSNATCRLYPNGLFQWDTPPP
LCQAVSCGIPQAVGNGSFHANRYTVRSQVSYQCGSGYYPDPDVPMTAVCLEDGSWSNAAA
PPRCLPIHCSSVEGILSEHMTYRLLTGRLGEFGSVMMLECATGYYLGVGHRTLQCLANGT
WEGSDDPATCKIISCGELPIPPFGTKLGTLTTFGATAIFMCNHGYTLVGSHVRECGANGL
WSGAETRCLAGHCDSPDPIVNGHISGDGSSYRDTVVYQCMLGYRLIGTSVRICQQDHRWS
GTTPVCVPITCGHPGNPANGRTNGSEFNLNDVVNFTCNRGYVLSGSARAQCRLNGQWSSS
LPVCKVVNCSDPGLVENGVRQSGLRYSEVFSYAVTIAIHCKRGFYLLGSALLTCQHDGRW
DRPIPRCLAISCGDPGVPPNAAVSGSRSWTYGSVIQYSCLHGGMLVGNVTRHCQEDSTWS
GAPPYCTGMNSGICGDPGLPPHGARLGGEEFKTKSLLRFSCEAGYSLIGSVERTCLHNGT
WSGTQPVCQAVSCGNPGAPAHGRIVFNDGVTFGSSVAYACWEGFKTSGLTTRHCTTNGTW
TGQPPDCVVISCGDPGPVANGIYIGSDFTYNHTVVYHCNPGHLMEPAEKGTLRCTKEGAW
NQTKPSCKVLQCSPPPQIYHGKVEGTDHFWGSSVSYSCFHGYQLSAPAVLTCEGNGTWTG
EVPQCLPVLCGDPGSPGGGYREGNIFSYRSEVRFYCQTPYLLVGSMSRVCQADGSWSGQQ
PACIDPAFNSCRDPGTPAYGIPVMAQGFQVGSKISFKCRKNYHILGSTTRTCLENLTWSG
TQPECIAHSCRQPETPANVDVRSMDLPTLGYTLIYTCQDGFYLAGGSEHRICRSDGRWSG
KPPLCKVGVKVSPKGRGESDVQKNKIRVPVDVFTPNSEWSGFYEYLGKRQATAFTVTGFN
ATSSRVNVTLLETSGVSIRLSGTYKSEDNQLLLKVYQVKGPTEHYLSKFKNDNWAMDGYV
TAESEQKTFVYQGHIHNKDFGKFHLARRASGPVTTATDLSNPYTNSSSVAAAILVPFFAL
ILSGFAFYLYKHRTRPKVQFNGYVGHESSNGQASFENPMYDTNMKPTEAKAVRFDTTLNT
VCTVV
Download sequence
Identical sequences H3D8G0
ENSTNIP00000002837 ENSTNIP00000016801 99883.ENSTNIP00000016801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]