SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016830 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016830
Domain Number 1 Region: 27-283
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-96
Family Protein kinases, catalytic subunit 0.0000107
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016830
Domain Number - Region: 281-341
Classification Level Classification E-value
Superfamily UBA-like 0.0278
Family UBA domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016830   Gene: ENSTNIG00000013826   Transcript: ENSTNIT00000017044
Sequence length 628
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:763532:773650:-1 gene:ENSTNIG00000013826 transcript:ENSTNIT00000017044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKSSGRSSMSRCRNSVSTTTSDDQPHIGNYRLLKTIGKGNFAKVKLARHVLTGKEVAVKI
IDKTQLNSSSLQKLFREVRIMKLLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVA
HGRMKEKEARAKFRQIVSAVQYCHQKCIVHRDLKAENLLLDADMNIKIADFGFSNEFTLG
NKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVL
RGKYRIPFYMSTDCENLLKKFLILNPSKRGSLEQQIMRDRWMNVGYEEEELKPYIEPQPD
YKDPKKTDIMLQMGFSLEEIQDSLVNQKYNDVMAAYLLLDYRNSEVHNSKHLEEGCIKPR
PGSEVSNINAPSPPHKVQRSVSSNQNPKNRRATEQVILTARSFRQGSSYSKRGGQTDNRS
AAEDSGRKGSSGSSTTKVPASPVVSADRKKSATPSTNSILSTGTGRSRNSPLSERATLAQ
GIQNGKDSLNTPGSRASTASAAAVLSSSSSASSSRPRHHKSLSSSNHPCPSDLHAPRPSA
PPQRAPGASPSAHNINSSAASERPNFSRGVGIRSTFHAGQQRGARDQQGSSYTSGPASPS
LSHGNTQARRTHGATGIFSKFTSKFVRR
Download sequence
Identical sequences H3D8I9
ENSTNIP00000016830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]