SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016848 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016848
Domain Number 1 Region: 5-95
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.51e-32
Family CAD domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016848   Gene: ENSTNIG00000013844   Transcript: ENSTNIT00000017062
Sequence length 148
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:1003117:1004444:1 gene:ENSTNIG00000013844 transcript:ENSTNIT00000017062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAIKSVTKRVWSPPQRPFRVCCHSRETKKGVIAGTLEELKQKVCHALLLSLSAVSVSLV
CEEDGTEVDTDDFLMTLPDNTTLMVLEPGQTWRPQPGSVVLKSAARDKPRTGKDIARVTF
DLYRMSPKDVFWLAEREGYISGPLFCEC
Download sequence
Identical sequences Q4S0S9
ENSTNIP00000016848 ENSTNIP00000016848 99883.ENSTNIP00000016848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]