SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016868 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016868
Domain Number 1 Region: 13-314
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.92e-83
Family Regulator of chromosome condensation RCC1 0.014
Further Details:      
 
Domain Number 2 Region: 355-434,472-499
Classification Level Classification E-value
Superfamily POZ domain 7.85e-24
Family BTB/POZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016868   Gene: ENSTNIG00000013864   Transcript: ENSTNIT00000017082
Sequence length 536
Comment pep:known_by_projection chromosome:TETRAODON8:2:11043929:11047768:1 gene:ENSTNIG00000013864 transcript:ENSTNIT00000017082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDLTKWPLFSLMSPQELSTIRKACVFGTSANEAIYITADDEVYALGLNCSNCLGTGDSQ
SSIVPKKVDILSGRKVVSLSYGSGPHILLATEDGELFAWGHNGYSQLGNGTTNQGVAPVL
VSANLLNKKVTEVACGSHHSMALTDSGEVYAWGYNNCGQVGSGSTANQPTPRRVSSCLQN
RVAVSIVCGQTSSLAVVDNGEVYGWGYNGNGQLGLGNNGNQLTPCRLVALQGLCVQQIVS
GYAHSLALTDEGLLYAWGANTYGQLGTGNKSNQLSPVQIMTEKERIVEIAACHSTHTSAA
KTQSGQVYMWGQCRGQSIVLPYLTHFACTDDVFACFATPSVMWRLLSVDHDDYLTVAQSL
KKEFDNPETADLKFCVDGKYIYVHKAVLKIRCEHFRSMFQSHWNEDLKEVIEIDQFSFPV
YRSFLEFLYTDNVELPPEDAIVSAPPGLLDLATSYCENRLKRLCQHIIKRGITVDNAFSL
LSAAVRYDAEDLEEFCFKFCVNHLTEVTQTAAFWQIDGNLLKDFICRASRCGAFRN
Download sequence
Identical sequences H3D8M7
ENSTNIP00000016868 99883.ENSTNIP00000016868 ENSTNIP00000016868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]