SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016875 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016875
Domain Number 1 Region: 408-440,500-699
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.63e-76
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000862
Further Details:      
 
Domain Number 2 Region: 35-137
Classification Level Classification E-value
Superfamily BRCT domain 5.5e-22
Family DNA ligase 0.026
Further Details:      
 
Domain Number 3 Region: 704-817
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 0.0000000000000419
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016875   Gene: ENSTNIG00000013870   Transcript: ENSTNIT00000017089
Sequence length 1228
Comment pep:known_by_projection chromosome:TETRAODON8:2:11209122:11215598:1 gene:ENSTNIG00000013870 transcript:ENSTNIT00000017089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRDGWMKKKANTSDDNGWAERGGYMAAKVSKLQEQFKLDAPKEKHKEGLSSDIFFGVSI
YVNGYTEPSADELRRLMMLHGGQFHAYYSRTNTTHIIANNLPHSKVKELKGQKVIRPEWI
TDSVKAGRLLPHLQYQLYASTHTSTDATHRTPSDHPHKPHPSPGQRACQLQPQISSSSSD
ARSSCRTPDLGRNGFLQTSLEVSSHLERSEPEECGKDDPPLHVVNEALLTNGHACLVNGA
LKPEDGSSDTDETSVGKDLSQSSLKNAADTPQSQFDAKLDPYEFPHSPLHSLTAPAVRLN
GCHNSKLSPKTASKSTPENASKAPVQLLAQTSGLISEFYSHSRLHQISTWRNSFSEYVNE
LHSRRKAAGARSFPGKERLRKFGAHQEGQGRHSPGDLTYLWSGVPFGVKSCIFHVDMDCF
FVSVAIRNRPDLKGKPVAVTSNRGAGTVLQRPGANPQLEQHYYQWKQSHPESDEDLYRTP
SQDGPGTHTGGAGQEAAALSMAEIASCSYEARQAGVRNGMFFGKAKQLCPSLQAVPYDFE
AYKEVALTMYDTLAGYTHDIEALSCDELLMDTSALLAELCVNPEELAKAIRADIKEKTGC
CASVGMGSNILLARLATRKAKPDGQYFLRSEDVDDFIRDLPVTSLPGVGPVMSRKLAAMG
VRSCGDLQQVSMSQLQKKFGPRTGQTLFRFSRGLDDRPVRYEKERKSVSADMNYNIRFTT
VDEAECFLTNLSMEVQKRLQEAGLRGRRVTLKVMVRKVGAPQEPAKYGGHGICDNLARTV
MLAASTDDGRLIAAAVIKLFHAMKLQVQDLRGVGIQVQLLDGNAHQASAGPRKRSIKDML
LDQGPGLCPCSYSTSWSVTSAEVCVVAIADNSTQQEKTSTTASSSSFPPQHLASPEPVPG
TSRGHQACRQTPRHSRARLNCSIEVPSPSQVRSPRGEARPAEVREQAWRQATARGAAAHR
RRGQRPCQARCRRRPPRRHRVHRGARWADRVQTSRTVPESYLELPNFSQVDPDVFAALPK
ELQEELRSAYNRGSDVQPPANICKSSVLEQKNPLLQLKQSGVGLGRVKRRYKRKNAGSPV
KKGLSPVKRNRATNSPAKPQEPASMIKAEVRPSTSTSKPETAESLPKILPRPTPTLAGAC
DLTDIRALLREWVTTITEPMEEDILQVVKYCTDLIEDKDLEKLDLIIKYMKRLMKQSAES
VWSMAFDFVLDNVQVVLQQTYGSTLKVS
Download sequence
Identical sequences H3D8N4
99883.ENSTNIP00000016875 ENSTNIP00000016875 ENSTNIP00000016875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]