SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016915 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016915
Domain Number 1 Region: 28-238
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.29e-49
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 251-291
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000222
Family SOCS box-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016915   Gene: ENSTNIG00000013910   Transcript: ENSTNIT00000017129
Sequence length 293
Comment pep:known_by_projection chromosome:TETRAODON8:2:11678305:11680794:-1 gene:ENSTNIG00000013910 transcript:ENSTNIT00000017129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAMAAVQTGCCLSWQRPLYIYGGLSCNSLMADSWSDRTPLHDAAYQGRLLTLRTLISQGF
HVDTLTMDLVSPLHEACLGGHYACAKFLLENGAKVDAASTDGATPLFNSCSSGSAACVGV
LLQHGASVYTPSPLASPIHEAAKKGHTECLDLLLSRGARVDVELPATGTPLYSACVARKA
DCVMSLLHSGADVETGCGQDTPLHAAARAGSAHIVDLLLDFGADRWSRNPEGKTPLELSP
PDSDVRLALQRRGPGSLSQLCRFCIRRCLGRSRLHRASSLFLPPSIKDFLLCP
Download sequence
Identical sequences H3D8S4
ENSTNIP00000016915 99883.ENSTNIP00000016915 ENSTNIP00000016915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]