SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016918 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016918
Domain Number 1 Region: 299-406
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.99e-45
Family ets domain 0.00000263
Further Details:      
 
Domain Number 2 Region: 155-244
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.53e-26
Family Pointed domain 0.0000831
Further Details:      
 
Domain Number 3 Region: 31-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000101
Family Ubiquitin-related 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016918   Gene: ENSTNIG00000013913   Transcript: ENSTNIT00000017132
Sequence length 440
Comment pep:known_by_projection chromosome:TETRAODON8:2:11695516:11699890:-1 gene:ENSTNIG00000013913 transcript:ENSTNIT00000017132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTDTEEMIEIEIDEREKQACLEEGVEEQTITASDLIQQDIDINEPVGNLKKLLEPRIQ
IPLDAYDICLQDIQLHPDHSLFDQGVKTDGTVQLSLQIITKPGEEKLNILEIVKPVETVE
VVIDPDAAGEEGTLVEDGQLIAVERSGLSDEASEQVTRWAAALEGYRKEQVRLGIPYDPV
LWSADQVIHWAVWVMKEFNIDEMEIGSIHIPGRDLCAFSQEEFLQKVPNGEILWSHLELL
RKYVLASQDQAGGDATVTIDQPVQIIPAQVNTPTAIKVLKQSRGPRAPRISGEERSSPGN
RTGNNGQIQLWQFLLELLTDKDARDCISWVGEEGEFKLNQPELVAQKWGQRKNKPTMNYE
KLSRALRYYYDGDMISKVQGKRFVYKFVCDLRTLIGYSAAELNTLVTECEQKKLARMQIH
GMGQPITTVTLATTTLDKES
Download sequence
Identical sequences H3D8S7
99883.ENSTNIP00000016918 ENSTNIP00000016918 ENSTNIP00000016918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]