SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016922 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016922
Domain Number 1 Region: 20-177
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.21e-39
Family Ankyrin repeat 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016922   Gene: ENSTNIG00000013917   Transcript: ENSTNIT00000017136
Sequence length 331
Comment pep:known_by_projection chromosome:TETRAODON8:2:11740983:11750555:1 gene:ENSTNIG00000013917 transcript:ENSTNIT00000017136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKMSVSVESGFSSEEVLSSRFPLHRACRDGDVGALCSLLQRASNPADLTVEDTFYGWTPI
HWGAHFGKLECVMRLVQVGCGVNAVTSRFAQTPTHIAAFGGHPECLRWLLQAGADVNRQD
YVGETPIHKAAREGSLECIKALLTWGAKADMRNASGLTAADLAYAQGFQECAEILSNAQN
FQQNMAQSPNGVFLNGLTHNGSHTFQGRSFLNGVANRKRSFDEAEANPVKKARPNGLGMQ
ANLLGWAGPLGGAGESLAESMELAAAVTSGGPGPFAFGLNECASSQGLGPMDGCEDQGGQ
NGSNPATKELEVITVASMQTPCRCTNSYAYL
Download sequence
Identical sequences H3D8T1
ENSTNIP00000016922 ENSTNIP00000016922 99883.ENSTNIP00000016922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]