SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016926 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016926
Domain Number 1 Region: 1380-1492
Classification Level Classification E-value
Superfamily C-type lectin-like 1.53e-42
Family Noncollagenous (NC1) domain of collagen IV 0.00000294
Further Details:      
 
Domain Number 2 Region: 1273-1379
Classification Level Classification E-value
Superfamily C-type lectin-like 1.74e-42
Family Noncollagenous (NC1) domain of collagen IV 0.00000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016926   Gene: ENSTNIG00000013921   Transcript: ENSTNIT00000017140
Sequence length 1493
Comment pep:known_by_projection chromosome:TETRAODON8:2:11764692:11777093:-1 gene:ENSTNIG00000013921 transcript:ENSTNIT00000017140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQGDFGLPGTTGLPGPPGLPGLQGNRGFYGPKFPHQGPPGDPGPRGQKGTMVKVLKGVKG
EQGEIGPMGPPGNSTYQQNRSPYGPPGFQGQKGLKGEPGDRADNKGETGMVGFSGPRGPS
GANGSAGIRGDLGDPGPRGRDGPKGDRGEPGELILLEDRWPGSTAVCAFYSNVGTTGTKG
GRGNRGVGGKVGAMGVEGIKGIKVWDLLGPFGFPGEEGDKGSRGEPGRPALFAGPEGSPG
RQGSPGPPGPKGTWSEWFKGAPGGRGRPGSAGFKGPKGSLSCWSLEGDHGQCECAIVNAP
PGPPGPAGDQGDAGMTGEFGKRGDVGDPGPQGEDGFSGPNGLIGQPGPKGQKGEQLVVKE
KGFQGESGDPGLSGEPGKAGAPGSNGVPGFPGSRGFQGEATQGHQGEKGFPGLSGQPGVA
GLRGEPGQDFIGVKGQRGLPGDAGFTGYEGVPGTPGSPDSSLPFAGPCNAVPGPRGPPGP
SGSNGLPGIPGPLGEKGFKGQPGARGEKGELGEQGIGGQPGLPGFPGPRGDPGFSGIRGS
EGVPGSDGITGQQGLKGEKGAHGEVLGASPGPPGDLGLPGIRGNKGPRGDPGTQGYEGMS
GVPGMIGSKGEQGPLGLQGEQGRPGPPGVYGYPGDPGRAGPPGPLGAVGQPGFTGERGTE
GDAGSPGPVGLKGTLGAYGEIGPIGESGPTGDPGLPGPDGQPGVPGMKGYKGSPGMSGFE
GMRGEAGVKGWSGQQGISGGFGQTGPKGLPGVKGQKGDRGLGGPPGEKPHISPVMIIHMK
GNKGEPGYQGYQGFPGPRGAKGFHGVPGHGGLHGLPGDPNNVKGHRGDLGAQGLPGIRGM
PGVSGKRGISGFKGMQGPKGIKGSTGAYGASGELGIKGTKGEKGQQIDLPGSTGFRGELG
LPGDPGAKGQKGFTGTVGERGSPGFEGIQGKKGESGNSGIPGFAGVDGQKGTPGNQGQRG
SPGIPGIDGHPGLPGYPGNTGFPGLKGLYGLHGLKGQKGLQGPPGLEIMGPTGDPGGKGP
KGDGGERNDQQGSPGSLGLKGFQGPQGDPGDPGLPGPRGLTGFDATPGPKVTKGFPGTRG
LPGLDGVHGEKGVPGISGFPGPVGLKGSKGGQGSFGYRGPDGVYGKKAGVKGEQGLMGVP
GVTGVQGDRGSTGPKGNVGATGFQGPPGNQGPRPFPPKIPGEKGSQGPWGTPGPHGVKGQ
MGPQGFPGDAGLMGPRGQKGMPGINGRPGVPGFRGDVGQRGHAGLQGMEGSRGRPGASGL
PGMPGRSVSVGYLLVKHSQTEQIPMCPVGMAKLWSGYSLLYMEGQEKAHNQDLGLAGSCL
PRFSTMPFLYCNPGDICYYASRNDKSYWLSTTAPLPMMPVEDVEIKPYISRCSVCEAPSV
AIAVHSQDITIPQCPVGWRSLWIGYSFLMHTAAGNEGGGQSLSSPGSCLEDFRTTPFIEC
NGAKGTCHYFANKHSFWLSSVDKSFHTEPKAETLKAGQLLLRIGRCQVCMKNL
Download sequence
Identical sequences H3D8T5
ENSTNIP00000016926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]