SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016939 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016939
Domain Number 1 Region: 279-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.49e-61
Family SPRY domain 0.000017
Further Details:      
 
Domain Number 2 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 2.43e-18
Family RING finger domain, C3HC4 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016939
Domain Number - Region: 144-229
Classification Level Classification E-value
Superfamily Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.0418
Family Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016939   Gene: ENSTNIG00000013934   Transcript: ENSTNIT00000017153
Sequence length 464
Comment pep:novel chromosome:TETRAODON8:2:12110170:12111561:-1 gene:ENSTNIG00000013934 transcript:ENSTNIT00000017153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TETMASMLSEELLLCPICLDVLNLPISTPCGHNFCKACIQGYWEAAELSQCPVCKQKLSR
GSEFKVNTLISELASQFRKLSEKRGDCGSSCVDGCSSQKDAVEVFKKHNRNKPKMTKTSV
SKKLRALFSNAKDTTVCQVDSLIKDRLQWINEINQTVEISRENAARETQDCLQIFQKLLQ
IVQKGQADLLEDIDAKQRQVELKAREMVVDLEQEMDALMRERAAGLPQCPVSSTPPAQRA
CLETAVFVGTVSGALTRVAGELQETVKVTVRRLYESEIQRARQYAVDVTLDPDTAHPKLI
LSENRKQVHHGDVALSLPDNPKRFYPGVSVLGREGFSSGRFYYEVLVKGKTEWDVGVGLE
TITRKGGNMLNPENGYWALGMRGGQSYWALSSTPVCVPLLEKLHRVGVYVDMEWGQVLFY
NVDAPSLIYSFTGYSFRQRLFPYFNPRRNQNGTNSAPLIIPPVD
Download sequence
Identical sequences H3D8U8
ENSTNIP00000016939 ENSTNIP00000016939 99883.ENSTNIP00000016939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]