SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016960 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016960
Domain Number 1 Region: 22-233
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.39e-51
Family Ankyrin repeat 0.0000727
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016960   Gene: ENSTNIG00000013954   Transcript: ENSTNIT00000017174
Sequence length 255
Comment pep:known_by_projection chromosome:TETRAODON8:2:12585423:12589457:1 gene:ENSTNIG00000013954 transcript:ENSTNIT00000017174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGRRETPQSSACRDAVFFSNSLMSDAESDWSPLHDAAFNGRVLALQSLLGQGTCVNLS
TLDRVSPLHAACVQGHLACAQLLIQNGANVNSSTVDGVTPLSEACARGHVALASLLLQRG
ANPSGSGHSNSPILKAAAKGHSECLEPLVQYGADVDQVMDQQGSPLHVACSNQHLSTVKK
LLELGACVNSSVRGESPLHTAARLSSPELTSVLLQHGAVPSLRNSEGNRPLDLTSPDSPV
GRLLRQGGSEATIPK
Download sequence
Identical sequences H3D8W9
ENSTNIP00000016960 99883.ENSTNIP00000016960 ENSTNIP00000016960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]