SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016973 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016973
Domain Number 1 Region: 204-329
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-30
Family Cadherin 0.00089
Further Details:      
 
Domain Number 2 Region: 423-548
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 101-208
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.0073
Further Details:      
 
Domain Number 4 Region: 547-643
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-20
Family Cadherin 0.0061
Further Details:      
 
Domain Number 5 Region: 317-427
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-19
Family Cadherin 0.0037
Further Details:      
 
Domain Number 6 Region: 4-74
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000542
Family Cadherin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016973   Gene: ENSTNIG00000013966   Transcript: ENSTNIT00000017187
Sequence length 889
Comment pep:known_by_projection chromosome:TETRAODON8:2:12785346:12788209:-1 gene:ENSTNIG00000013966 transcript:ENSTNIT00000017187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNTIRYQTNEEGAPGTVIGTLAKDMSLSLASSKTNFRMMKQFNDSFIRVRESDGELTVGE
RIDRERICRHTPQCLITFDVVNFSKDRYKLIHVAVEIRDINDNSPEFPNKESIVEISENV
AVGSRVPLDPAADADVGSNYIQSYQISVNSHFTIDVLLRADGVKYAELVLMKELDRETQS
SYSVDLVATDGGHPFRSGSTKITILVTDFNDNSPVFDQNSFSVSLPEDAPVGSVILNLNA
VDADDGLNGEVVYGFGKQVSHEIRQLFQVDHKSGRLTLRSPVDFEEKSTYELDVQASDLG
ANPSPSLCKIIIHITDVNDNAPEISITPMTSMTTGIAYISEAADKDSLVALVSTQDRDSG
VNSQVHCSLYGHDHFRLKQAYEDSYMIVTAAVLDRERISEYNLTVMAEDFGSPPLRKIIQ
YTIRLSDENDNAPHFARAVTEVSVVENNPPGAYITTVEASDADLGNNGKITYRLVDSAIM
GSPVNTFVSLNSVSGSLYALRSFNYEVMKQLDIHVQASDGGSPQLQTTAVIRLKILDQND
NQPSIVAPQLYKGSAEVFLPKDSPAGYVVTQIKATDADEGINAQLSYKIIEGGHLGFSIN
KDTGKVHVSRQLTYDLSDNVKVTVAVSDNGSPSLTSTAIIHVSFTEGTLPSVPSLAQNDS
EELFEWDTSIAIIIVLAGSCSLLLLAIILITTLCNRRRKETREGGHDEKEDVPDVEKAES
GHIDSLIASRKGKVFDAHPLPENPPLASGNATDTGCEDGRQAAGMFESNSRTMEGKLKAE
SSESFCILTQTPKLCVLAGLFHAARLWKGNSQANNNLERDPHISGKDSGKGDSDFNDSDS
DISGDVHKKESPPTNKLFLSTGLWACTSECKVLGHSDRCWSPSATRPNT
Download sequence
Identical sequences H3D8Y2
99883.ENSTNIP00000016973 ENSTNIP00000016973 ENSTNIP00000016973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]