SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016974 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016974
Domain Number 1 Region: 446-573
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-31
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 227-352
Classification Level Classification E-value
Superfamily Cadherin-like 8.25e-31
Family Cadherin 0.0036
Further Details:      
 
Domain Number 3 Region: 124-231
Classification Level Classification E-value
Superfamily Cadherin-like 8.38e-22
Family Cadherin 0.014
Further Details:      
 
Domain Number 4 Region: 557-673
Classification Level Classification E-value
Superfamily Cadherin-like 8.7e-21
Family Cadherin 0.0044
Further Details:      
 
Domain Number 5 Region: 340-450
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-19
Family Cadherin 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016974
Domain Number - Region: 26-122
Classification Level Classification E-value
Superfamily Cadherin-like 0.000186
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016974   Gene: ENSTNIG00000013967   Transcript: ENSTNIT00000017188
Sequence length 953
Comment pep:known_by_projection chromosome:TETRAODON8:2:12808843:12812198:1 gene:ENSTNIG00000013967 transcript:ENSTNIT00000017188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVWNVALVVLCVELSLFVTTLCTTTRYVTYEEDKLGTEIGNLSRDLKIDPADDPDTSFR
LMQENNSSVIQMREVDGLLSVADVIDREQLCPRSLRCLITFDIVVRAKEKFQLIHVEIEV
KDINDHPPRFPHNETHLEIVENVPLGSRFPLEIALDQDVGENYIQSYNISPSSHFEVEVR
DQEDGLKFAELVLVRELDREVEDSYTIKVTATDGGVHARSGSMLVNIKVLDSNDNSPSFE
HSSLTVELDEDSPVGHRVLRVHAFDPDEGVNGEVTYALAAGFSPEVGRLFHVDPYTGEVT
LKGLVDFERRRLYELVIKASDMGANSVPSTCKVHIDVVDVNDNAPEISIKPMTPGSDGVA
SITEAAAADSFVALISTSDRDSGSNGYVRVSLLGHEHFSLQQAYGDSFMIITTTALDRER
IPEYNLTVVAEDLGNPPFKTVRQYTVRVKDENDNPPLFSKTLYEVSVLENNIPGSYVTTV
VARDPDVGENAKVSYKVLDAEVPGGSPVSTYVSVDSHSGSLYTLRSFDYETLQQIDLVIQ
AEDRGSPSLSSTSTIRIKVVDQNDNYPYFTFPVLQNDSADVPLPFNAPAGYLALRVSAED
EDEGMNKVLSFQIFQGDTNLFRVDKDSGEIVLKQWLSAEIGDVLEIKISVSDNGRSPLSS
SATIRFLVSDTEPSADQVFLVLPSSHREGLSWDGSFIVIIILSGGCALLLVAIVAVVVTC
KFGRRARRDGSKRDACRSLFDSRPLPMLGSAESNIYTGPRGFFPERTPSSLDDSCLYEER
SADSEAKMFLPSKHFQRTSAWQSDKYCLQVSGTGNTDQLSVKDSGKGDSDFNDSDSDISG
DGGKKNFLTFQPRQHNHGTYCAAPPPQSFRTARENSYTLGFSPAPVFASPHGYGHSWKVS
AYGTNCPKSRGSTQSFSRTGTLPPYFPQQQREVQTHNPNFVTVATALEVATIF
Download sequence
Identical sequences H3D8Y3
ENSTNIP00000016974 ENSTNIP00000016974 99883.ENSTNIP00000016974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]