SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016975 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016975
Domain Number 1 Region: 433-558
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-29
Family Cadherin 0.0024
Further Details:      
 
Domain Number 2 Region: 219-341
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-28
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 114-223
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-21
Family Cadherin 0.0036
Further Details:      
 
Domain Number 4 Region: 333-437
Classification Level Classification E-value
Superfamily Cadherin-like 4.45e-21
Family Cadherin 0.0055
Further Details:      
 
Domain Number 5 Region: 548-654
Classification Level Classification E-value
Superfamily Cadherin-like 3e-20
Family Cadherin 0.0036
Further Details:      
 
Domain Number 6 Region: 16-111
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000103
Family Cadherin 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016975   Gene: ENSTNIG00000013968   Transcript: ENSTNIT00000017189
Sequence length 951
Comment pep:known_by_projection chromosome:TETRAODON8:2:12826559:12838936:1 gene:ENSTNIG00000013968 transcript:ENSTNIT00000017189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVPIFFLLWVKALTLKNLNYSVPEEQGPGTVIGNIAKDAGYGTTERGKKSNFRVLENSAP
HLVDVDPESGLIFTKQRIDRETLCRRNPKCQLSMEVFANDKEICMIKIDILDINDNSPSF
PSDHINIDISENAAAGTRFPLTIAHDSDTGENGIKTYQVTRDDYNTFSLDLKVRGDGTIY
PELVVQRPLDREDESHHTLLLTAIDGGEYPRSGSMQINVRVTDSNDNSPVFEKSSYVIEI
PENSPPGKILIDLNATDHDEGSNGQVVYSFTGYASERIQDLFSIDPNTGVVKVQGEIDFE
ENPIIEFDVQAKDLGPNPIPGHCKITVKVLDKNDNSPIISFVSVRQGAISEAAPPDSVIA
LVRVTDKDSGRNGQLQCRVLGNVPFRLQENNDNFYTLLTDRPLDREMKDEYNVTIVARDN
GIPSLNYTKSFTVKILDENDNAPRFTKTVYMLQVPENNIPGEYLGSIVAHDPDIGRNGTV
SYSILPSHIGDVSVYTYVSVNPTNGAIYASRSFNYEQTKSFEFKVQAKDGGAPHMESTST
VRVNILDVNDNLPVIILPILLNDTAEIPVPRNVGIGYIVTTVKAVDHDHGESGHLTYEIT
EGNDEHLFEIDPVGGEVRTAHSLWEEVAPVVELVVKVTDHGKPPLSAVAKLIIKANAETA
AGGGSSTSGEQQQWDLSLPLIVTLCIISVMLLAVMTAIAVKSKHQDKETGNYNCRMTEYS
NPPVGKGKKKRINKSDIMLVQKSPAAHTAQVGGHVSENHPKQPDSPQRKCVTTCKQSESS
VMWLRPCQIHCCRLKTKPCLKCGLGQMEQMHADASKHANLTAQTENFSSEPNYAGNRQPF
VQSSTFKDAERASLRDSGHGDSDQADSDQDTNKGSHCEQDKSAHCTDECRALGHSDRCWM
PKLRVGSQADSADNRTNLFIPVGMDAMVETEIYGTISCSSRKTLSTFGKEQ
Download sequence
Identical sequences H3D8Y4
99883.ENSTNIP00000016975 ENSTNIP00000016975 ENSTNIP00000016975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]