SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016986 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016986
Domain Number 1 Region: 44-125
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.87e-25
Family First domain of FERM 0.0026
Further Details:      
 
Domain Number 2 Region: 125-180
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000493
Family Second domain of FERM 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016986   Gene: ENSTNIG00000013979   Transcript: ENSTNIT00000017201
Sequence length 184
Comment pep:known_by_projection chromosome:TETRAODON8:2:13129851:13144911:1 gene:ENSTNIG00000013979 transcript:ENSTNIT00000017201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELDPEPTAFGAGQRLGAPETLGISTLDPAHRPPAMPPGRHVTIRVRMLDDTEELFDVS
QKASGKVLLDLVCSHMNLVEGDYFGLEFQNHQKIMVWLDHIKPIIKQLRRPKHTILRFAV
KFFPPDHAQLLEELTRYLFALQIKQDISSGRLTCNDTSAALMVSHIIQSEIGDFEESKCR
SHLL
Download sequence
Identical sequences H3D8Z5
99883.ENSTNIP00000016986 ENSTNIP00000016986 ENSTNIP00000016986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]