SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017007 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017007
Domain Number 1 Region: 163-251
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000118
Family Ankyrin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017007   Gene: ENSTNIG00000014000   Transcript: ENSTNIT00000017222
Sequence length 253
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:5189672:5191527:-1 gene:ENSTNIG00000014000 transcript:ENSTNIT00000017222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFPTQSSFQRVLPLLNITVASLHPLTDQKLYEIVNAGTLGRGALPWAEFTHRLEQLSPF
LLRRNDGSRMLKHASFREWLMWREEGQDDRFLCDPRSGHTLMAFWLCRQEGKLNRQQVLD
LGHHILKAHIYKGLSKKLGVSSSVLQGLWLAYSTQSLSPALSSLRNLYTPNIKVSRLLIM
GGADVDHRTDVLSNAPLLCAHAHLGHADVVALLLDQGAQVDAQSHDGVSALGFAAAAGHL
DIVTMLSQNAAKV
Download sequence
Identical sequences H3D916
ENSTNIP00000017007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]