SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017008 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017008
Domain Number 1 Region: 1-343
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.17e-72
Family Ankyrin repeat 0.0000598
Further Details:      
 
Domain Number 2 Region: 355-478
Classification Level Classification E-value
Superfamily TPR-like 4.56e-20
Family Tetratricopeptide repeat (TPR) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017008   Gene: ENSTNIG00000014000   Transcript: ENSTNIT00000017223
Sequence length 1025
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:5185121:5189919:-1 gene:ENSTNIG00000014000 transcript:ENSTNIT00000017223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVALLLDQGAQVDAQSHDGVSALGFAAAAGHLDIVTMLSQNAAKVGHVDNSGRCVLVHAA
QRGHIEVLCYLLRNADWSCTPCCSQKAASKDQAVQQALTAAASMGHAQVVSYLLDLSGKD
DKNGQSPEINTPDSLWGETALSAAAGSGRLSVCSLLLEQGAAVDRGNRRGVTPLFSAVKH
NHWQVVQLLLNHRVDVNSVDQQGRTALMVAASEGHLTTARLLLDHGASLDQTDREGLTAL
SWACLKGKLQLVKELVDRGAATTHADRSGRTPLDLAAFCGDPEVVQYLVDHGASVEHVDC
SGMRPLDRAVGCRNTSAVIALLKKGAKIDRSDRKPATWAMATSKPDILMVLLSKLTQEGD
RLYKQGNASEAAQSYQAALQKFPADELKTFRKLRVCVLLNLSRCHRKMNDFEVAEQFATK
ALELKAKSYEAFYARARAKRSRRQFHAALEDLIEASRLCPSNREIQRLLSRVKEECRQVA
WQHESPPDCLHHLYQQNSIKEMRQRDSGCLQGQEKEGLSYSGGDALQHSSSFHPAIQSLD
SQGHSASLSPTHQYRHHASPATQRHLSPPPSPMQQQQRASPMTEAVCALPGNGGLLQYAQ
PVPAGYYPDQHQGAQQHHLTSSQRSFQKQNPVPGQWLQPAKVQVVRPSQPSSTANAGAIL
GSSIYSHFGQLPQELAELGEGLCPSLLHMRPGLPVQTGLSSGASYLPSGAESDFVCQGRS
APAYGRNGGGERPGLSRFGQARQLNRNQSKAAHYPMEVTEATMGPPDSYIAAHQYHQMGL
RRPLSAHPGSPSAPPSRPFVHSQNPSVRFSTSSGSLASGQPVTPGPGFRTSASVQQMELT
SDPVPLGEAPGHHEDFFLTQSEICMSGGGTYPGEAGRSSRNTPFMGVSDRTARVHQHYQH
APSSPPSCLSPSRSWAVSSVDTVLTSPTKTPAGQGQFQPPSLAYHNRSNNNAHYGPLPDS
QHHHYEARPGCAAQGDAPPHLSSFVGMRLARTLPVIHGYPERPAERKTGPTSPVKPKRPF
VESNV
Download sequence
Identical sequences H3D917
99883.ENSTNIP00000017008 ENSTNIP00000017007 ENSTNIP00000017008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]