SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017023 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017023
Domain Number 1 Region: 9-232
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.05e-54
Family Ankyrin repeat 0.0000551
Further Details:      
 
Domain Number 2 Region: 519-591
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.16e-21
Family SAM (sterile alpha motif) domain 0.0044
Further Details:      
 
Domain Number 3 Region: 238-322
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-16
Family SH3-domain 0.0028
Further Details:      
 
Domain Number 4 Region: 457-521
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.89e-16
Family SAM (sterile alpha motif) domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017023   Gene: ENSTNIG00000014015   Transcript: ENSTNIT00000017238
Sequence length 1400
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:4889000:4912477:-1 gene:ENSTNIG00000014015 transcript:ENSTNIT00000017238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SELLGSAKKVNVNFQDTDGFSPLHHAALNGNLELITLLLESQAAVDIRDQKGMRPLHYAA
WQGKAPMKMLLKSGSSVNGQSDEGQIPLHLAAHGHYDVSEMLLQHQSNPCIVDNAGKTPL
DLACEFGRVGVVQLLLSSNMCAALLEPKKGDTTDPNGTSPLHLAAKNGHIDIIRLLIQAG
IDINRQTKAGTALHEAALCGKTDVVRLLLESGINATVRNTYSQTALDIVYQFTATQASRE
IKQLLRDASAALQVRALKDYCNNYDLTSLNIKAGDVITVLEQHPDGRWKGCIHDNRTGND
RVGYFPSTMVEVISKRSCRGTEASPHCSPTPSCGPHGGSNEEIWVLRKPVFAGGDRSSLG
SSSSVNSVRSSGSGQSAGSAPHILHAQAEGVKLLATVLSQSAKAKEHLLEQTKSMDQPAG
SNSSSRTSSQSGCPLHEAPPYEATAARKGEGPGEGKSSEAVVQWLSDFQLQVYAPNFLGA
GYDLPTISRMTPEDLTAIGITKPGHRKKLTSEINKVSVSEWLPEHKPANLGEWLSAIGLS
QYHQVLVQNGYENIEFITDITWEDLQEIGITKLGHQKKLMLAVKRLAEMQRSSEGRSSFK
KKPPPITQQQEVMSMDSPPPDVVPSFSAEVMSPKMSTFQDSELSSELQNAMSQPGHEISK
AQRARSFSKDHDEAMTGGGGPPKKEARTMRQQSSQGSSSSSRGSVSSQGKRHSHSHSQPA
PPYTPPHTPTKTRTSSSSSTSSAQSIASPQSKPKPAHFGQGERPQSPRSHSNQSPTHRGA
LCVTEVKDNQQSQVPLLCLPPEGEMPEGDGAESSALQKKRAHSLNRYAVSDGEGDEPVGG
GRNGGKAPAAGGQGSAASKAEGEKYATVTHRVSRSHSVRNQDKSASRNQTQSFALRQKKK
GPPPPPPKRSSSAISSSNSNLADANAQPQTHATAGGLLDVPYHQQRRASDLGVSVETAPV
ETNSAGSVRSIAAMLEMSSIGGGAKGMALQKNFLQMPDRAFSPATQVGKTREAIGLDGEV
VNRRRTISGPVTELVEAASSGGSGSSSENLPFAEEGSLTIRRQGRGEGQGDGDGPQADGG
YAQEDVSRPEANPTLKRRPRSTKSQPNGADFTLQESSTVKRRPKSRDKEPDGFAELAAAN
TQPAAFQNGTATVKRRPTSDASVTDQSPPQAAAARRRNSVEQAAPGSTDGGPARKPKPPV
SPKPIVAQIKRQGGPQTPPHPASNKSIPLPGPGTPGSPVEGKKIPPPVSPKPAPPPTAPK
PAKLVHSMTSSSSPPGLPPTNIPSPPNAKPLSPSPQSPHTPQTPPTPQTPATPSPTPPPV
KPPRSSIGGVSVDSGTPGDFLVQQKLEETSASLAAALQAVEDKILHQEDSVAEQKTTVSI
LDDIGSMFDDLADQLDAMLE
Download sequence
Identical sequences H3D932
ENSTNIP00000017023 ENSTNIP00000017023 99883.ENSTNIP00000017023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]