SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017026 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017026
Domain Number 1 Region: 3-193
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-30
Family Laminin G-like module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017026   Gene: ENSTNIG00000014018   Transcript: ENSTNIT00000017241
Sequence length 1105
Comment pep:known_by_projection chromosome:TETRAODON8:21:5102270:5119982:1 gene:ENSTNIG00000014018 transcript:ENSTNIT00000017241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGFDLMAYFNVREILGTKEDDGQSSYVRLGTVPIVQQTEDIFPQGLPDEYAFVTTFKFRK
TSRREDWYLWQVFDKYGIPQVSIRLDGENKAVEYNAVGLTKDAVRAVFKNPEVDNLFDRS
WHKIALSVEAKSVSLFLDCKHIQTLPIEEREDIDIQGKTVIGKRLYDSVPIDFDLQRMMI
YCDSKHAELETCCDLPNGPLSVSQESGDRSPTSADTNSNTNRRRAKERPPGELLLPSRSQ
VGKKASVFLLQGDIGAPGAAGPKGEKGESGSIGLPGLPGQKGEKGDAGIKGDKGTSGGEM
GLDGSPGKPGLPGKDGLRGLAGVPGPTGFKGDKGDAGPPGPPGATGPPGPPGPRGLQGFP
GEPGEFGQRGPQGPPGPPGNQGHPGPPGLPGKDGLDGLPGNDGTMGDEGSPGPRGPPGER
GERGLEGPVGPKGEKGDKGKPGEKGEKGDQGKPGETGPKGDPGPTGEPGRVGDPGPPGAA
GAPGLRGVAGDAGLPGIIGPPGPAGQRGDKGDPGKPGQPGPTGTPGEPGVIGPPGPPGKG
KDGQSGEPGPQGIQGAPGPKGQPGARGEQGPPGERGSPGEGKVGPAGPPGQSGEPGAAGL
TGPPGVAGLPGRPGEKGSPGEPGKAADISDLDLKVGVIGIVLLNVCSDCPAGPPGPPGIP
GVPGEKGHPGPAGKSGQDGYQGQPGPAGPQGPPGADGVKGGKGDQGPPGGPGDKGDAGHP
GPPGHPGNPGLMGTPGTDGQPGPAGPPGPPGEKGKEGLKGIQGPPGLPDVNVTVAHYLYT
KLHNVINDGQGQIGKTGKDGRPGEPGEQGKHGEPGPPGNPGLRGIPGFKGHRGEPGAPGV
KGEDGKPGSPGRDGKHGKDGSRGPPGPEGLLGPRGEPGKQGEPGPSGKAGLPGTAGIPGR
AGDRGIKGDKGDLGKKGDKGHSGDPGMPGNPGVPGRKGHTGMMGMPGPPGEIGAPGVQGP
VGNPGIPGQRGESVSLEEMRRLIQEELAKQLDTRLAYLMAQIQPAHVKSTAGRPGPPGPP
GKDGSPGRPGPPGEPGMPGMNGGPAGIPGYAKDGSPGQAGAQGEPGNPGPAGQPGPSGPP
GQCDPSQCAYYASLAQRPHTKKKGK
Download sequence
Identical sequences H3D935
ENSTNIP00000017026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]