SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017031 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017031
Domain Number 1 Region: 743-927
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.73e-38
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.018
Further Details:      
 
Domain Number 2 Region: 8-92,163-225
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000456
Family Canonical RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017031   Gene: ENSTNIG00000014023   Transcript: ENSTNIT00000017246
Sequence length 927
Comment pep:known_by_projection chromosome:TETRAODON8:21:5348720:5354567:1 gene:ENSTNIG00000014023 transcript:ENSTNIT00000017246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVDNQEERALEVLNLPPNIDQELLVLYFENKRRSGGGPLVWRKRGHTAIVVFEETEAAA
RVLSKEVHALQNTDLRVRRAAGKDQRRLLLRGIRPSTSVDFVELYVENTLGLTLEEYELC
FPPARDSVLIQLGQPLTQDFQTLSAKISQRLINGASLTLEEVEQTDSVLVRNLQPSTSPE
MLSLYFESRGGAHAVMDVTKLSESTARVSFADYDSVDLVLAQPHKLKGADLEVRPYFDFL
QPTAASDPQADSPEDAGDKEQSSHMASEIPAETSQTAAAQGAEDLTEEVPLTDFISIADP
VKQEAQFLDRAEVKARLQRSMSQTPATYMVLDSNVVVTALSCTSADQACSFVKSQLAHVS
TEDIDVLTLKGMESEMQTVVTEFLTSQIESEVVVCMEPDVLKYIQAHCHRLLVDMDQVSV
IPLESLDVSGFKIYGHPVACSTAKEMLQGIVSSICTKTITVSSPGIARYLLEKDCTMFLS
SMEEEFQVYITVTFTSAAIHLDEPSAEITELLESAKKVITALDDGFLMDQTSANQCASSD
DMDLYPTEEDEAPDATGAGILYTNESLSVEDEQLRSPEDLEEEANLSLAIQYSMDSNQRS
MEEEEQLQKALMLSKEVNQYEMMESATDQLNEAISASLEEAVKASNTVQFHVFATNEASL
QQVDTAFKKRAIERKHGVEIQTEGTIINIFGFNKFVSQALYDVQLLLSRMLHSPSNQEIL
QEMQAHNTASGENSVLKTLPSATKVDEDSNEFRLVAEAFNNGICEYKNKIQIVQVDRLEN
RLLYHQYQLKRMSIQQTSTQAEFEKTLYHGTSEESMKEICLHGFNRSFCGKNATVYGQGV
YFAVNSAVSLNDRYSPPNADGHKFVFVSRVLTGDYTKGCSSMKAAPLKPGSDVPFRYDSV
TNNMDNPKIFVIFSDTQAFPQYLITCK
Download sequence
Identical sequences H3D940
ENSTNIP00000017031 99883.ENSTNIP00000017031 ENSTNIP00000017031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]