SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017089 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017089
Domain Number 1 Region: 49-210
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.00000000000242
Family ADP-ribosylating toxins 0.02
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000017089
Domain Number - Region: 226-313
Classification Level Classification E-value
Superfamily Lipocalins 0.0505
Family Retinol binding protein-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017089   Gene: ENSTNIG00000014081   Transcript: ENSTNIT00000017305
Sequence length 447
Comment pep:known_by_projection chromosome:TETRAODON8:18:2373446:2376740:-1 gene:ENSTNIG00000014081 transcript:ENSTNIT00000017305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDETSPLVSPLRDSGDFSYRPTEPTSPRGAFGGTPGSVVRIPAGSPGRSRERQPLLDRDR
GSSQRDPHRNEFPEDPEFREIIRKAERAIEEEIYPERIYQGSSGSYFVKDSQGKIIGVFK
PKNEEPYGQLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPKTK
VVYLASETFNYSAIDRVKSRGKKLALEKVPKVGQRFHRIGLPPKVGSFQLFVDGYKDADF
WLRRFEAEPLPENTNRQLQLQFERLVILDYIIRNTDRGNDNWLLKYDCPMDSAANRETDW
VLVKNPIIKLAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVSFSQEIRELVLPKLCDPN
FIKDLEEDLYELFKKDPGFDRGQFYKQAAVMRGQILNLCQALKDAKTPLQLVQMPPVIVE
TARASQRASSESYTQSFQSRRPFFTWW
Download sequence
Identical sequences H3D998
ENSTNIP00000017089 99883.ENSTNIP00000017089 ENSTNIP00000001583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]