SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017122 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017122
Domain Number 1 Region: 339-522
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-66
Family SPRY domain 0.00000706
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 8.62e-21
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 111-166
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000382
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017122   Gene: ENSTNIG00000014113   Transcript: ENSTNIT00000017338
Sequence length 523
Comment pep:known_by_projection chromosome:TETRAODON8:18:1867943:1870519:1 gene:ENSTNIG00000014113 transcript:ENSTNIT00000017338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAGAFLCEDQFTCSICLEVFENPVSTPCGHSFCQSCISSYWDGGRGAGRVYLCPICKE
SFRKRPELHINRTLKEITEQFKHIASAGSGLPSSPDSGPEARYTLSGPSSSSPPPPLCPV
HQRGLEFFCHTDGVCVCSACVDRAEHRGHSVSPAKREWQIKKSQLGISEMELKGLLSERE
KKAEEIQESLKAIQAAAESQTDGAMCAFSKLISSVESCQTDVLEVIELSRRAAEHRAQSL
LKELEEELTELRKRSAALSQLSRSEDYVHFLKTFPGLSAHPQTKDWSGVGLASELTSGAA
LRTVSHVMEQIQEEMQRLPESCQRILLDQSAPRTNPKIKRVQEYAADITLDPYTAHPRLI
ISPDGKQVHCGERHQQIPDNPERFDRVVCVLAHQGFSSGRHYWEVDVGGKTDWDLGVASR
SVNRKGKITVSPAHGYWFLSLRDQSEYAFRTEPSTSLALSIRPSRIGIYVDFEKGVVSFY
NVEARLLIFTFADAFPDTIYPFFSPCTNKSGRNEAPLIIRPVA
Download sequence
Identical sequences H3D9D1
ENSTNIP00000017122 99883.ENSTNIP00000017122 ENSTNIP00000017122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]