SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017144 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017144
Domain Number 1 Region: 374-540
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-49
Family SPRY domain 0.00031
Further Details:      
 
Domain Number 2 Region: 137-200
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000244
Family B-box zinc-binding domain 0.00075
Further Details:      
 
Domain Number 3 Region: 6-56
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000013
Family RING finger domain, C3HC4 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017144   Gene: ENSTNIG00000014134   Transcript: ENSTNIT00000017360
Sequence length 544
Comment pep:novel chromosome:TETRAODON8:18:1493524:1495673:1 gene:ENSTNIG00000014134 transcript:ENSTNIT00000017360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSSFPLPPELYCPLCADTLRDAVTIPCGDTYCLDCIKIYWDQFDHTGVYSCPQCHATF
TPRPVPRHSPPDVNQEPRRQLPELAPFPYMHRESYCDFCVGRRSKAVKSCLVCLAYYCEA
HVKPHYESSTFKRHKLVDETGHLDRKICPHHEKGLELFCRSDQMCICVLCTVREHRGHNI
ASAEEERIEKQKILVVTQSEVQYIIQERMKELQELKHNVDVLKSGAQRAQAESEKTFHEM
LQAAERWKAEINQMIVSNMQAAMSQADGYVERLEQEIMELQRRDAELRQILETEDNIHFL
QNFPTLCVPPEAMVPKVLINPQFSFGEMSKTAVDMKEHLDDICKKELSKISKTVPSRADL
QEPKTRSDFLRYACRMTFDPNTAYKELVLSEGNQKVTRKKTVHFYPDHPERFDGFSQLLC
KEPLSGFRFYWEAEWSGEFSIGVAYRSISRKGKNSHSLLGYNDRSWSLLCSDSGYSVWHS
KVDRDLPNAPRATRIGVYLDYAGSTLAFYAVKETMELIHKFKAQFSEPLYAGFGVGSSVT
LCQL
Download sequence
Identical sequences H3D9F3
ENSTNIP00000017144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]